KEGG   Acyrthosiphon pisum (pea aphid): 100169168Help
Entry
100169168         CDS       T01076                                 

Definition
ubiquitin carboxyl-terminal hydrolase calypso-like
Orthology
K08588  
ubiquitin carboxyl-terminal hydrolase BAP1 [EC:3.4.19.12]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100169168
Peptidases [BR:api01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   100169168
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 505 aa AA seqDB search
MPVDLHRLIQGWLELESDPGLFTLLLEDFGVKGVQLEEIYDLQKPLDGPVYGFIFLFRWI
EERRSRRKIVDQTDIFVKDDDAINSIFFAQQMIPNSCATHALLSVLLNCSDIHLGETLGH
LKEHTRGMNPENKGWAIGNTPELARAHNSHAMPKSRPRMDKTPGLTTGRFTGEAYHFVSY
VPINGHLYELDGLKPYPMDHGPWAEEEDWTEKFRRVISDRLGAAAEYSDIRFNLMAVVPD
KRLAITHKLNMLKTNRRIVLEALQQLVLVDDFEKKRKINDNDQSPKCVKKDISPIPGTSK
DYNEEKTCPESDNIVVIRVQSSSSGSEGDGNPKDIKSVCLEAGAMPKGWETPSSHSSDKE
DNNDQKLENNIKSNHTFSPKDLLALVKNLELEINMSEGILREENEKRNKYKIDDCRRTHN
YDQFICTFLTMLAQKGILPDLVQQHLGAQKKNTSAQLSLSVQSQSTNQTQVKSKSNKPNS
KSNTASTTTRLRTKRKKTTKKGRKS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgccagtggatttacataggctcatccaaggatggttggaattagaaagcgatcctggt
ttgtttactttgcttttagaagattttggagtgaaaggagttcagctagaagagatttat
gaccttcagaaaccattggacggtccagtttatggttttatatttttgttccgatggatt
gaggagcgtcgtagccgcagaaaaattgtagaccaaacagacatatttgtcaaagatgac
gacgctattaacagtatattttttgcacagcaaatgatacctaatagttgtgctactcat
gccctgctgtctgttttgctaaactgctcagatatacatctaggtgagacattgggacat
cttaaggaacatactcggggtatgaatccagaaaataaaggatgggctattggaaacact
cctgaattagcacgagcacacaattcacatgctatgccaaaaagtagaccacgtatggat
aagacaccgggattaacaactggacggtttaccggtgaggcatatcactttgtcagttat
gtacccattaatggtcatttatatgaattggacggattgaaaccatatcccatggaccat
gggccttgggctgaagaagaagattggactgaaaagtttagaagagtgataagtgatcga
cttggagcagcagctgagtatagtgatatacgattcaatctgatggctgttgttccagac
aaacgattagctattacccacaaattaaatatgctcaaaacaaatagacgaattgtatta
gaagctttacaacaacttgtactagtagatgattttgaaaaaaaaagaaaaatcaatgat
aatgatcaatcaccaaaatgtgtaaaaaaagacatttcacccattcctggcacttcaaaa
gactataatgaagaaaagacctgtccagaatcagataatattgtagtaatccgtgtacaa
tcatcaagtagtgggtcagaaggtgacggaaatccaaaagacataaaaagtgtatgtcta
gaagcaggagctatgcctaaaggatgggaaacaccttcaagtcattcttcagataaagaa
gataataatgatcaaaaattggaaaataatataaaatccaatcatacattttctcctaaa
gacttattggctctagtcaaaaatttagaacttgaaataaacatgagtgaaggtatctta
cgagaggagaatgaaaaacgtaataaatataaaattgatgattgtcgacgtacacacaat
tatgatcagtttatatgcacgtttttaactatgttagcccaaaaaggtatattacctgat
ttagttcaacaacacttgggcgcacaaaaaaaaaatacaagtgcacagctttcactttct
gtacaatctcaatctacaaatcaaacacaggtgaaatcaaaatccaataaaccaaattca
aaaagtaatacagcgtcaactacaacaaggctcaggacaaaacgcaagaaaactactaaa
aaaggacgtaaatcatga

DBGET integrated database retrieval system