KEGG   Acyrthosiphon pisum (pea aphid): 100169208Help
Entry
100169208         CDS       T01076                                 

Definition
acyl-CoA Delta(11) desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100169208
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100169208
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100169208
Lipid biosynthesis proteins [BR:api01004]
 Desaturase
  First
   100169208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 352 aa AA seqDB search
MVQMGAKTTTITECDMLQQETHLLKDGQNEQVTTNYDREESQFPVSKQEIIWTNVVFITL
LHVLFVYCFCNYFFSTKWQTYVWSFIVGGIGGFGVTGGAHRYFTHRSFKAKLPLQLILIL
CYTVSGQNNIPDWVRDHRVHHKFSETDADPHNANRGFFFSHVGWLMQRKHPEVYRKGKTI
DMSDINNDPLVKFHTKHFLLFKMLFCFIIPVLISVYALNENWAEAISSLAVVRYVLNLNF
TWSVNSVAHIWGSKPYDKRIQPAQNVVVSIVAMGEGWHNYHHSFPWDYRAAELGGYSLNT
TTLWLDLFAAIGWAYDLKTASKQLIQQVAVNQGDGSWRQEPETAHARDYKTS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtccagatgggcgcgaagacgacgaccataacggagtgcgacatgttacaacaggag
acacacctgttgaaggacggccaaaatgaacaggtgacgaccaactacgaccgagaagag
tcgcaattcccagtcagcaagcaagaaatcatatggacgaacgtcgtgttcatcactctg
ttgcacgtcttattcgtatattgtttttgcaactacttcttctccacgaaatggcagaca
tacgtatggtcttttatagtcggcggtattggtggatttggagttaccggcggcgcacat
cgatatttcacacatagatcgttcaaagcgaaattaccattacaactaatactcatattg
tgttacacagtatcgggacagaacaacataccggattgggttcgcgaccaccgagtgcat
cacaagttcagcgagacggacgccgacccacacaatgcaaacaggggcttcttcttctcg
catgtcggttggctgatgcaacgcaaacatcccgaggtctacagaaagggcaagaccatc
gacatgtctgacatcaacaacgatccactggtaaagtttcacaccaagcactttttactg
ttcaagatgttgttctgtttcattatacccgttttgatatcggtgtacgcgttgaatgaa
aactgggcggaagccatcagctcactggccgttgtccgatacgtgttgaacttgaacttc
acgtggtccgtcaacagcgtagctcacatctggggaagcaagccgtatgacaaacgcatt
caaccggcacagaacgtggtggtgtccatcgtggctatgggcgagggctggcacaactat
catcactcgttcccgtgggactacagggcggccgagctcggcggatactcgttgaacacg
accacgctgtggctagacctattcgccgccatcggttgggcgtacgatctcaagacggcg
tccaagcagctcattcagcaggtggccgtcaatcaaggcgacggaagctggcgacaggaa
ccggaaacggcgcacgcacgggactataagacttcataa

  All links  
No link information was found.   
DBGET integrated database retrieval system