KEGG   Acyrthosiphon pisum (pea aphid): 100169208Help
Entry
100169208         CDS       T01076                                 

Definition
acyl-CoA Delta(11) desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:api01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:api01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 352 aa AA seqDB search
MVQMGAKTTTITECDMLQQETHLLKDGQNEQVTTNYDREESQFPVSKQEIIWTNVVFITL
LHVLFVYCFCNYFFSTKWQTYVWSFIVGGIGGFGVTGGAHRYFTHRSFKAKLPLQLILIL
CYTVSGQNNIPDWVRDHRVHHKFSETDADPHNANRGFFFSHVGWLMQRKHPEVYRKGKTI
DMSDINNDPLVKFHTKHFLLFKMLFCFIIPVLISVYALNENWAEAISSLAVVRYVLNLNF
TWSVNSVAHIWGSKPYDKRIQPAQNVVVSIVAMGEGWHNYHHSFPWDYRAAELGGYSLNT
TTLWLDLFAAIGWAYDLKTASKQLIQQVAVNQGDGSWRQEPETAHARDYKTS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggtccagatgggcgcgaagacgacgaccataacggagtgcgacatgttacaacaggag
acacacctgttgaaggacggccaaaatgaacaggtgacgaccaactacgaccgagaagag
tcgcaattcccagtcagcaagcaagaaatcatatggacgaacgtcgtgttcatcactctg
ttgcacgtcttattcgtatattgtttttgcaactacttcttctccacgaaatggcagaca
tacgtatggtcttttatagtcggcggtattggtggatttggagttaccggcggcgcacat
cgatatttcacacatagatcgttcaaagcgaaattaccattacaactaatactcatattg
tgttacacagtatcgggacagaacaacataccggattgggttcgcgaccaccgagtgcat
cacaagttcagcgagacggacgccgacccacacaatgcaaacaggggcttcttcttctcg
catgtcggttggctgatgcaacgcaaacatcccgaggtctacagaaagggcaagaccatc
gacatgtctgacatcaacaacgatccactggtaaagtttcacaccaagcactttttactg
ttcaagatgttgttctgtttcattatacccgttttgatatcggtgtacgcgttgaatgaa
aactgggcggaagccatcagctcactggccgttgtccgatacgtgttgaacttgaacttc
acgtggtccgtcaacagcgtagctcacatctggggaagcaagccgtatgacaaacgcatt
caaccggcacagaacgtggtggtgtccatcgtggctatgggcgagggctggcacaactat
catcactcgttcccgtgggactacagggcggccgagctcggcggatactcgttgaacacg
accacgctgtggctagacctattcgccgccatcggttgggcgtacgatctcaagacggcg
tccaagcagctcattcagcaggtggccgtcaatcaaggcgacggaagctggcgacaggaa
ccggaaacggcgcacgcacgggactataagacttcataa

DBGET integrated database retrieval system