KEGG   Acyrthosiphon pisum (pea aphid): 100169250Help
Entry
100169250         CDS       T01076                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100169250
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100169250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 676 aa AA seqDB search
MDQWLLWFGYLVASTYGLSLRHARHQSVGTPTAEEILEPQILIEDTDHVFRQRASDMFAQ
EPEYTEKRNLNHRRRSEFSGNQDNDFESSGETYSAYKSDDPLVIHTNKGKIRGITQAAST
GKLVDAWLGIPYAKKPIGDLRFRHPRPIDRWDKTSPETILNCTTPPNTCVQIFDTLFGDF
PGATMWNPNSPVSEDCLYINVVVPKPRPQNAAVMVWIFGGGFYSGSATLDIYDPKVLVSE
ENVILVSMQYRVASLGFLYFDTEDVPGNAGLFDQLMALQWVHENIKLFGGNPNNVTLFGE
SAGAVSVSLHLLSPLSRNLFNQAIMESGSSTAPWAILSREESFSRGLKLAKAMGCPDDRN
DIHKTVECLRKVNSSAMVEKEWDHVAICFFPFVPVVDGAFLDDYPQKSLSTNNFKKTNIL
MGSNSEEGYYSIFYYLTELFKKEENVVVSRENFVKAIGQLNPNADAAVKSAIEFEYTDWF
SPNDPEKNRNALDKMVGDYQFTCNVNEFAHKYALTGNNVYMYYFKHRSLNNPWPKWTGVM
HGDEISYVFGDPLNPNKRYETEEIELSKKMMRYWTNFAKTGNPSKTFEGSWVTPKWPIHT
AYGKEFLTLDTNNTSIGVGPRLEQCAFWKNYVPDLTAISKSMKSDKNCTTISGGTKTNMI
KLSLWTIVMTTVVLML
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtggttgttgtggtttggctacttagtagcttctacttatggactttcattg
cgccacgccaggcaccaaagcgttgggacaccaacagccgaagaaatactggaaccacag
attctaattgaggacaccgatcatgtattcagacaacgagcgtcagatatgtttgcccaa
gagccagaatacacggagaagcgaaacctcaatcatagacggaggtccgaattcagtgga
aaccaggataatgatttcgaatcttctggggagacatacagtgcttataaatcggatgat
ccgttggtaatccacacgaacaagggtaagattagaggcatcacacaggcagcgtcgact
ggaaagttagttgatgcatggctaggaataccctacgcaaaaaaaccaataggtgatctt
aggtttaggcatcctcgcccaattgaccgttgggacaaaacaagcccagagacgattctt
aattgcactactccaccaaacacatgcgttcaaatattcgacacgctttttggtgatttt
cctggtgctacaatgtggaatccaaattccccggtatcagaagattgcctttacattaac
gtagtagtgccaaagcctagaccacaaaacgctgcagtgatggtgtggattttcggcggt
ggattttactccgggtctgctacattggatatttacgatcctaaggtactcgtatcggaa
gaaaacgtgattttggtatccatgcagtacagggttgcatcgttaggctttttatacttc
gacactgaagacgttccaggaaacgctggactttttgatcagctcatggctttacagtgg
gtacacgagaacataaaattatttggcggcaacccaaacaacgtgacacttttcggtgag
tcagccggcgccgtttcagtttcactgcacttactgtcaccgctgagtagaaaccttttt
aatcaagccatcatggaatcaggatcctcaacagcaccttgggcgattttgtcacgggaa
gaaagttttagtagaggacttaagctagcaaaggcaatgggatgtccagatgacagaaac
gacatacataagacggtcgagtgcttaaggaaggtgaacagttcagcgatggtcgagaaa
gaatgggatcacgtggctatatgttttttcccatttgtcccggtggttgatggcgctttt
cttgacgattatcctcaaaagtccctgtcaacaaacaatttcaaaaaaacgaatatactc
atgggtagtaactccgaagaaggttactattcaatattttattatttgacggagcttttc
aaaaaggaggaaaacgtggtggtgtctcgtgaaaattttgttaaagctattggacaactt
aatccgaatgcagatgcagctgttaaatcggctatagagtttgaatacacggattggttt
agcccaaacgacccagaaaaaaatcgaaacgctttggacaaaatggtcggtgactatcag
tttacatgcaacgtcaatgaattcgctcataaatatgcacttactggaaacaacgtgtac
atgtattactttaaacatcgttctttgaacaatccatggccaaaatggacgggtgtgatg
catggtgatgaaatcagttatgtatttggagatccattaaatccaaataaacgctacgaa
actgaagaaattgaactcagcaagaaaatgatgagatactggaccaattttgcaaaaaca
ggaaatccaagcaaaacatttgaagggtcttgggtcacgcccaagtggcctatacacacg
gcgtatggaaaagagtttctaacattagatacaaataacacttctatcggcgttgggcca
agactagaacaatgtgctttttggaaaaactacgttcctgatcttacggccatttcaaag
agtatgaagtctgacaaaaactgtacaaccataagtggagggaccaaaactaatatgatc
aagttatcgctttggacaattgtgatgacaactgtcgttttgatgttatga

DBGET integrated database retrieval system