KEGG   Acyrthosiphon pisum (pea aphid): 100169333Help
Entry
100169333         CDS       T01076                                 

Definition
(RefSeq) eukaryotic translation initiation factor 4e 1a-like
  KO
K03259  
translation initiation factor 4E
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100169333
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100169333
Messenger RNA biogenesis [BR:api03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100169333
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100169333
Translation factors [BR:api03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100169333
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
APHIDBASE: 
UniProt: 
Position
Un
AA seq 214 aa AA seqDB search
MVEGEPVNQSDELPKVENEQPIETESAIAELVVKHPLENKWTLWFFENKSKIWEENIHEV
ASFDTVEDFWCLFNHIKRPSQLLNQCDYNYFKNGIKPMWEDGKNSAGGRWLLQLPPAKNS
QLVDEYWKNIILSIIGEIYDQSSEINGAIVNVRNKGTKIAVWTNNASKDNSSNIMAIGRK
IKEVLGAQNEKMVYESHADTANKQGSFTKHAFMI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggttgagggagagccagttaatcagtcagatgaattaccgaaagttgaaaatgaacaa
ccaattgaaacagaatcggctattgcagaattagttgttaaacatccattagagaataaa
tggacactttggttctttgaaaataaaagtaaaatatgggaagaaaatatacatgaagtt
gctagttttgatactgttgaagatttttggtgcttattcaatcacatcaaacgtccaagt
caacttttgaaccaatgtgattacaactattttaaaaatggaatcaaacctatgtgggaa
gatggaaaaaatagtgccggtggtcgttggttattacagttaccaccagcaaaaaatagc
caacttgttgatgaatactggaaaaatataatattaagtataattggtgaaatatatgac
caaagttctgaaattaatggagctatagttaacgtacgaaacaaaggaactaagatagca
gtatggacaaacaatgcatcaaaagataatagcagcaatattatggctattggaagaaaa
ataaaagaagttttgggcgcacaaaatgaaaagatggtttatgagtctcacgcagataca
gcaaataaacaaggatcatttacaaaacacgcatttatgatataa

DBGET integrated database retrieval system