KEGG   Acyrthosiphon pisum (pea aphid): 100169347Help
Entry
100169347         CDS       T01076                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:api00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 333 aa AA seqDB search
MSYPNKVIHSGYFNDTLRQWQCQNTQITPLNLMYPIFILDEKDVREEIKSMPGIYRQGLN
HVKAMLDPVVESGLKSILIFGVINKLSKDQCGTHADSLENPVIQALPLLKKWYPNLVIAC
DVCLCPYSSDGHCGIVENQQIDNIKSIKRIGEIALSYALAGADIVAPSCMMDGHVTAIKQ
SLMKENLLSRVSVLSYSAKFCSVFYGPFRDAANCAPSFSNRSSYQIPVGSSSIAERVVDR
DISESCDMTMVKPGMMYLDIVRKVKDKHPNIPIFIYQVSGEYAMLYYAVQAGVVQLREGL
LEILRSMRRAGGDVIVTYYTPEILKWLKDVPIL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagttatccaaataaagttattcatagtggatattttaacgacactcttaggcaatgg
cagtgtcaaaatactcaaattactcctttaaatttaatgtatcctattttcattttagat
gaaaaggacgtaagagaagaaataaaatcaatgccaggaatctatcgacaagggttaaat
catgtcaaagccatgttggatccagttgttgagtcagggcttaaatccatcttaattttt
ggtgtgatcaataagttatcaaaagaccaatgtggaacacatgctgattctcttgaaaat
ccagttattcaagctttaccgttgttaaagaaatggtacccaaatcttgtgatagcttgt
gatgtatgtttatgtccatactcgtctgatggacattgtgggatcgttgaaaaccaacaa
atagacaatataaaaagcattaaaaggataggagaaatagcattatcatatgctcttgct
ggtgcagatattgtcgctccatcttgtatgatggatggacatgtaacagctattaaacaa
agtttaatgaaagagaatttgttgagtcgagttagtgttttatcatattctgcaaaattt
tgttctgtattttatggaccattcagagatgctgcaaattgtgcaccaagttttagtaat
cgctcatcatatcaaattcctgtaggaagttcaagtattgcagaaagagtggtggataga
gatatctctgaatcctgtgatatgactatggtaaaacctggtatgatgtacttagacata
gtaagaaaagttaaggataaacatccaaatataccaatatttatttatcaggtgtccgga
gaatatgcaatgttatattatgctgtacaagcaggtgtagtacaattaagagagggttta
cttgaaattttaagaagtatgcgacgagccggtggtgatgtaatcgtgacttactatact
ccagaaattttaaaatggttaaaagatgtaccaatattataa

DBGET integrated database retrieval system