KEGG   Acyrthosiphon pisum (pea aphid): 100169347Help
Entry
100169347         CDS       T01076                                 

Definition
delta-aminolevulinic acid dehydratase-like
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100169347
Enzymes [BR:api01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100169347
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100169347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 333 aa AA seqDB search
MSYPNKVIHSGYFNDTLRQWQCQNTQITPLNLMYPIFILDEKDVREEIKSMPGIYRQGLN
HVKAMLDPVVESGLKSILIFGVINKLSKDQCGTHADSLENPVIQALPLLKKWYPNLVIAC
DVCLCPYSSDGHCGIVENQQIDNIKSIKRIGEIALSYALAGADIVAPSCMMDGHVTAIKQ
SLMKENLLSRVSVLSYSAKFCSVFYGPFRDAANCAPSFSNRSSYQIPVGSSSIAERVVDR
DISESCDMTMVKPGMMYLDIVRKVKDKHPNIPIFIYQVSGEYAMLYYAVQAGVVQLREGL
LEILRSMRRAGGDVIVTYYTPEILKWLKDVPIL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgagttatccaaataaagttattcatagtggatattttaacgacactcttaggcaatgg
cagtgtcaaaatactcaaattactcctttaaatttaatgtatcctattttcattttagat
gaaaaggacgtaagagaagaaataaaatcaatgccaggaatctatcgacaagggttaaat
catgtcaaagccatgttggatccagttgttgagtcagggcttaaatccatcttaattttt
ggtgtgatcaataagttatcaaaagaccaatgtggaacacatgctgattctcttgaaaat
ccagttattcaagctttaccgttgttaaagaaatggtacccaaatcttgtgatagcttgt
gatgtatgtttatgtccatactcgtctgatggacattgtgggatcgttgaaaaccaacaa
atagacaatataaaaagcattaaaaggataggagaaatagcattatcatatgctcttgct
ggtgcagatattgtcgctccatcttgtatgatggatggacatgtaacagctattaaacaa
agtttaatgaaagagaatttgttgagtcgagttagtgttttatcatattctgcaaaattt
tgttctgtattttatggaccattcagagatgctgcaaattgtgcaccaagttttagtaat
cgctcatcatatcaaattcctgtaggaagttcaagtattgcagaaagagtggtggataga
gatatctctgaatcctgtgatatgactatggtaaaacctggtatgatgtacttagacata
gtaagaaaagttaaggataaacatccaaatataccaatatttatttatcaggtgtccgga
gaatatgcaatgttatattatgctgtacaagcaggtgtagtacaattaagagagggttta
cttgaaattttaagaagtatgcgacgagccggtggtgatgtaatcgtgacttactatact
ccagaaattttaaaatggttaaaagatgtaccaatattataa

DBGET integrated database retrieval system