KEGG   Acyrthosiphon pisum (pea aphid): 100169427Help
Entry
100169427         CDS       T01076                                 

Definition
histone deacetylase 3-like
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
api  Acyrthosiphon pisum (pea aphid)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 433 aa AA seqDB search
MSNKRVFYFYNPDVGNFHYGPAHPMKPHRLSVIHSLVLNYGLYNKMKIYRPYRASAHDMC
RFHHDEYIEFLQRVTPQNLTTYSKYLNHFNVGEDCPVFEGLYDFCSMYTGASLDGAMKLN
KNCCDIAINWSGGLHHAKKFEASGFCYVNDIVIAILELLKYHPRVLYIDIDVHHGDGVQE
AFYLTDRVMTVSFHKYGNWFFPGTGDMYEIGADVGRYYSVNVPLKEGIDDFSYSQVFKPV
IQHVMDLYQPTAIVLQCGADSLNGDRLGCFNLSTKGHGECVKFIKDLNVPLLTVGGGGYT
LRNVARCWTYETSLLIDEEISNTIPEHEYRDYFAPDFLLHPEVVTRQENANSKQYLELIV
KHTYDNLKMVQHSPSVQIQNVPGDALPTEEFNAIALDEVDPDVRQSQVELDRRVDAPNEF
YQDDKDQDFDETR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataagcgtgtgttttacttttacaaccccgacgtgggcaatttccactatggg
cctgcacaccccatgaagccacaccgtttgtcggtcatacacagtttggtattgaactat
ggtctctacaataaaatgaaaatctatcgtccttaccgtgctagtgctcacgacatgtgc
cggttccatcacgatgagtacattgaattcctccaaagggtaacgccacagaacttgacc
acgtacagcaaatacttgaatcattttaatgtgggcgaagactgtcccgtattcgaaggt
ctatatgatttttgttccatgtatacgggcgcttcactagacggggcaatgaaactaaac
aaaaactgttgtgatattgccataaactggtcgggtggtcttcatcatgccaaaaagttt
gaagcatctggattttgttacgtaaatgatattgtgattgctattttggaactattaaaa
tatcatccaagagttttatatattgatattgacgtacatcacggtgatggtgtccaagaa
gcgttctatttgacagatcgtgtaatgactgtatcttttcataagtatggcaactggttt
ttccctggtactggtgacatgtacgagattggagcagatgttggaagatattattctgta
aatgtccctttaaaagaagggattgatgattttagctattcacaagtgtttaaacctgta
attcaacatgtgatggatctttaccaacctacagcaattgttcttcagtgtggcgcagat
tcattaaatggtgatcgtttgggttgttttaatctgagtactaaaggacacggcgaatgt
gttaaattcattaaagatttaaatgtacctcttttaacagttggtggtggagggtatact
ttaagaaatgttgcacggtgttggacatatgaaacatctcttttaattgatgaagaaatt
agtaatacaattcctgaacatgagtatcgtgactattttgctcccgactttttattacac
cctgaagttgtgacacgacaagaaaatgccaacagtaaacaatacttggaacttattgtt
aaacatacctatgataacctaaaaatggtacagcactcgccaagtgtacaaattcaaaat
gtacctggtgatgcacttcctacagaggaatttaatgctattgctttagatgaagttgat
ccagatgttagacaatcacaggttgaacttgatcggagagttgatgcaccaaatgaattt
tatcaagatgacaaagatcaggattttgatgaaactagataa

DBGET integrated database retrieval system