KEGG   Acyrthosiphon pisum (pea aphid): 100169431Help
Entry
100169431         CDS       T01076                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100169431
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     100169431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 320 aa AA seqDB search
MSKIVVIGSCNTDMFFYTSKLPNLGQTIHGKKFTLDFGGKGANQCIAAQKLGADTVFIGC
VGSDIFGRDIISNFERWGVDTQFITKKSVDTGVAQINVTDNGENYIIIVAGANSTLQKED
VDKAYDLLLKETSVVLFQFETPLETTEYILNKLSTANSKCCKIVNGAPVYTNSYQNILKL
ADIFCVNESEAEVYTNCIKKINSIETANEVLSLLLKQGCKIVIITLGSLGAVFASKDERE
PQWVKVPKIENPIDTSGAGDAFLGSLAYFIVHTPNLSLYEQIRRACIIATRTVQFQGTQK
SYPLKHDLPEELFNQNYINI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagattgttgttattggttcatgtaatactgatatgttcttttatacatcaaaa
ttgcctaaccttggacagacaatacatggaaaaaaatttactttagactttggtggtaag
ggagcaaatcaatgtattgctgcacagaaacttggagctgatactgtatttattggttgt
gttggatcagacatttttggtagagatattataagtaattttgaacgatggggagtagac
actcaatttataacaaaaaaatcagttgatacaggagtagcacaaataaatgttactgat
aacggagagaattatatcattatagtagctggagctaacagcacattacaaaaagaggat
gtggataaagcatatgatttattactcaaggagactagtgttgtactatttcaatttgaa
acaccattggaaacaacagagtacatacttaataagctttctacagccaacagtaaatgt
tgtaaaattgtaaatggtgctccagtttatacaaattcttatcagaatatacttaaatta
gctgatatattttgtgttaacgaatctgaggcagaagtttatacaaattgtataaagaaa
attaatagtattgaaacagccaatgaggttttatcattacttttaaaacaaggatgtaaa
attgtaataattacattaggatctctaggtgccgtatttgcatctaaagatgaacgagaa
ccacagtgggttaaagtgccaaaaatagaaaatcctattgatacctctggcgctggtgat
gcgtttttgggatctctggcttatttcattgttcatacaccaaatttgagtttatatgaa
caaattagaagagcatgtattatagctactaggacagttcaatttcaaggaactcagaaa
agttatcctttaaaacatgatttacctgaagaacttttcaatcaaaattatataaatata
tag

DBGET integrated database retrieval system