KEGG   Acyrthosiphon pisum (pea aphid): 100169493Help
Entry
100169493         CDS       T01076                                 

Definition
mitogen-activated protein kinase 14B-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100169493
Enzymes [BR:api01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100169493
Protein kinases [BR:api01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100169493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 352 aa AA seqDB search
MKYYKIEINKTEWEVPDRYQMLTPVGLGAYGQVCSAVDNQTGLKVAIKKLARPFQSAVHA
KRTYRELRMLKHMNHENVIGLLDVFTPANTMNNFNQLYMVTHLMGADLNNIIRTQKLSDD
HVQFLVYQILRGLKYIHSAGIIHRDLKPSNIGVNEDCELKILDFGLARPTESEMTGYVAT
RWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIQQLNLILEILGTPSNE
LMQKISSESAKKYIQSLPVMPKKDFGEVFKGANPLAIKLLEEMLELDADKRMTAEKALAH
PYLAQYADPSDEPNSPPYDQSFEDMELNVEKWKELVWEEVVSYVPSTQLESP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattacaaaatcgaaattaacaagaccgaatgggaagtacccgataggtatcaa
atgctcactcccgttggtcttggtgcctacggccaagtttgctcagctgttgacaatcag
acggggctgaaagttgctatcaaaaaacttgccagaccatttcagtcagcggttcatgct
aaacgtacctatcgagagcttcgcatgttaaaacacatgaaccatgaaaatgtgattgga
ttattagacgtgttcacacctgcaaatactatgaataattttaatcaattatatatggtc
acccatttaatgggagctgacttaaataatatcatacgtacacaaaaattatctgatgat
catgttcaatttcttgtttaccaaattttacgaggtttgaagtacatccattctgctgga
ataatccatagagatttaaaaccatcaaatattggtgtaaatgaagattgtgagctaaaa
atattagattttggattagcaagaccaactgaaagtgaaatgactggatatgtggctacc
agatggtacagagcacctgagattatgttaaactggatgcattacaatcagacagttgat
atttggtcagtaggctgcattatggctgaacttttgacaggaaggacattatttcctggc
acagatcacatacaacaattaaatttgattttggaaatattaggcaccccatcgaatgaa
ctgatgcaaaagatatccagtgaatcggcaaaaaaatatatacagtctttaccggtaatg
ccgaaaaaagattttggtgaagtattcaaaggagctaatccattagcaattaaactgtta
gaagaaatgttggaattggacgctgataaaagaatgactgctgaaaaagcacttgcacat
ccatacctggcgcaatatgctgatccatctgacgaaccaaattcacctccatatgatcaa
agctttgaagatatggaattaaatgtagaaaaatggaaagaacttgtctgggaagaagtt
gtaagttatgttccatccacacaattagaatcaccataa

DBGET integrated database retrieval system