KEGG   Acyrthosiphon pisum (pea aphid): 100169493Help
Entry
100169493         CDS       T01076                                 

Definition
mitogen-activated protein kinase 14B-like
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
FoxO signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:api04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 352 aa AA seqDB search
MKYYKIEINKTEWEVPDRYQMLTPVGLGAYGQVCSAVDNQTGLKVAIKKLARPFQSAVHA
KRTYRELRMLKHMNHENVIGLLDVFTPANTMNNFNQLYMVTHLMGADLNNIIRTQKLSDD
HVQFLVYQILRGLKYIHSAGIIHRDLKPSNIGVNEDCELKILDFGLARPTESEMTGYVAT
RWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHVDQLTRLLVLSGTPSDE
YLNKIKSSEAKKYIQSLPVMPKKDFGEVFKGANPLAIKLLEEMLELDADKRMTAEKALAH
PYLAQYADPSDEPNSPPYDQSFEDMELNVEKWKELVWEEVVSYVPSTQLESP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattacaaaatcgaaattaacaagaccgaatgggaagtacccgataggtatcaa
atgctcactcccgttggtcttggtgcctacggccaagtttgctcagctgttgacaatcag
acggggctgaaagttgctatcaaaaaacttgccagaccatttcagtcagcggttcatgct
aaacgtacctatcgagagcttcgcatgttaaaacacatgaaccatgaaaatgtgattgga
ttattagacgtgttcacacctgcaaatactatgaataattttaatcaattatatatggtc
acccatttaatgggagctgacttaaataatatcatacgtacacaaaaattatctgatgat
catgttcaatttcttgtttaccaaattttacgaggtttgaagtacatccattctgctgga
ataatccatagagatttaaaaccatcaaatattggtgtaaatgaagattgtgagctaaaa
atattagattttggattagcaagaccaactgaaagtgaaatgactggatatgtggctacc
agatggtacagagcacctgagattatgttaaactggatgcattacaatcagacagttgat
atttggtcagtaggctgcattatggctgaacttttgacaggaaggacattatttcctggc
acagatcatgtggatcaattaacacgtttattagttttgagtggaacgccgtccgatgaa
tatttaaataaaattaaaagctcggaggcaaaaaaatatatacagtctttaccggtaatg
ccgaaaaaagattttggtgaagtattcaaaggagctaatccattagcaattaaactgtta
gaagaaatgttggaattggacgctgataaaagaatgactgctgaaaaagcacttgcacat
ccatacctggcgcaatatgctgatccatctgacgaaccaaattcacctccatatgatcaa
agctttgaagatatggaattaaatgtagaaaaatggaaagaacttgtctgggaagaagtt
gtaagttatgttccatccacacaattagaatcaccataa

DBGET integrated database retrieval system