KEGG   Acyrthosiphon pisum (pea aphid): 100169501Help
Entry
100169501         CDS       T01076                                 

Definition
multifunctional protein ADE2-like
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100169501
Enzymes [BR:api01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     100169501
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     100169501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 428 aa AA seqDB search
MAKPQNKGIGMGELIIEGKTKLVYDLPGTDNVLMVSKDRITAWNGAKGDEMQGKAAISTE
TTTAIFKVLQDLGINTAFVSKNGLSDNTFISKKCSMIPIEWVSRRIATGSFLKRNPGVKE
GYRFTPPLVETFFKDDKNDDPQWSEQQLLSVEFNIGNITIGSAEYEIMRKTTICVFEVLE
KLWASKDVALVDMKIEFGVSSEGQILVADVIDNDSWRLWPSGDKRLMVDKQVYRNLSTVT
AADMETIKTNFKWVAQQVQSFSQKQPNGLVVVVMGSSSDESFGKKIAEYTKNVMGINTEI
RIGSAHKSTEFVLKMIDKYEGLRIPVVIVAVAGRSNGLGPVIAGYTNLPVINCPPLNATN
INMDIWSSLNVPSGLGCVTVREEEGAALAASRIIGLTDPLVWCKLKTQQLEKYITLIKND
QEIVSKNL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccccaaaataagggtattggtatgggtgaattgatcatcgagggaaaaacc
aaacttgtatacgatctacccggcacggacaatgtgttgatggtaagtaaagacagaata
accgcttggaatggtgccaagggcgatgaaatgcaaggtaaagcggctatatctaccgaa
acaacgacagctatatttaaagttttacaagatttaggaataaatacagcatttgtttca
aaaaacggtttatctgataatacattcattagcaaaaaatgtagtatgattccgattgaa
tgggtatctcgtcgaattgctacaggatcttttctgaaacgtaatccaggagtaaaagaa
ggttatagatttactccacctttggtggagacctttttcaaggatgataaaaatgatgat
cctcaatggtctgaacaacagttgctatccgtagagtttaacattggaaatataacaatt
ggaagcgctgagtatgagataatgagaaaaactactatctgtgtgtttgaagtattggaa
aagttgtgggcatctaaggatgttgctttagtagatatgaaaatagaatttggtgttagt
tctgaaggtcaaatattagtagctgatgttattgacaatgattcatggaggttgtggcca
agtggagacaaacgattaatggttgacaaacaagtgtacagaaatttgagcactgtcaca
gctgctgatatggaaacaattaaaacaaattttaaatgggttgctcaacaagttcaaagt
ttttctcaaaaacaaccaaatggtttggttgtagttgtcatgggttcatctagtgatgaa
agttttggtaaaaagattgcagaatatacaaaaaatgtaatgggtatcaatactgaaatt
agaattggatcggcacataaaagtacagaatttgtattgaaaatgattgataaatatgaa
ggtttacgtattcctgttgtcatagttgctgtagctggtcgtagtaacggcttgggtcca
gtaatcgctgggtatactaatttgccagttataaactgtccacctttaaatgcaaccaat
ataaatatggatatttggtcttcattgaatgttccatctggtttggggtgtgtaactgta
cgggaagaggaaggagctgctttggctgcatctcgtattattggattgaccgatccccta
gtttggtgtaagctcaagacacaacagttggaaaaatatattaccttgataaaaaatgat
caagaaattgtttcaaaaaatttgtaa

DBGET integrated database retrieval system