KEGG   Acyrthosiphon pisum (pea aphid): 100169505Help
Entry
100169505         CDS       T01076                                 

Definition
DNA repair and recombination protein RAD54B-like
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:api03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 842 aa AA seqDB search
MIMRRSRAPSQQFPLVPKEDIIKGVKVIRTPSEILALIKTHDNKTINNVSAAVQPASHTI
KNCDTPLQLPQNISKKIKNSVVHKTIKPNKHASEIDEQQEVKENVIQPSNTLESKKYNVT
WGKQTKKKHKTWEGDGYLIVSDKFAALHDLDGHKLGSTSDLKSLNLEDGSIIVVGNKQVQ
VLDLVTEFDTAAIEKSTVTSCAEPLRKRPKILVDVSSPEALIMPEPDIDHQSFFNKKKEE
ITSVVLEPFLAKHLRPHQKTGIIFLYECVSGFKAQECFGAILADEMGLGKTLQTICLVWM
LLKRGPYGGIPLAKRVLIVAPSSLVGNWENEFTRWLGRDRLRLFSVDQKKKPSEFARLPA
RSYPVMITSYEMLVRYIEEIEKLHFDLMVCDEGHRLKNNSTNTYLALTKIECKRRVLLTG
TPIQNELAEFYALIDFVNPGILGTYSMFKREFEDKIVESQQPECHPQIISLGKRKASELN
EVTEKFILRRTQDVNNKYLPSKYESVVFCAMAPIQCRLYEETVSYWENRVQEFGLSTISH
FSVITMLKKVCNHPELILNNRNNSDTTEETLNQHLNRTITLKHSLIESSGKLIVVDNLLK
ELHKNGSEKTVLISYYTQTLDIFVKLCDMKHYKYLRLDGSTATAQRTDIVKKFNNSNSNY
SVLLLSAKAGGVGLNLVGASNLILYDSDWNPASDQQAMARIWRDGQKKNVHIYRLLTSGT
IEEKIFQRQISKTGLSEAITNPDNQNNTKLSFEQLKDLFNFKKDALCSTHDLLECNCGGK
GVVLSDNSAFECDDKKSEAPLRVNELMKWEHHSSPFNTDVLEAMNLFGVSTTIRFLFRNK
AN
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgagaagaagtcgtgcaccatctcaacagtttccacttgttcctaaagaggat
attataaaaggagtgaaagtcataagaacaccatctgaaattcttgcgctgattaagaca
catgataataaaacaataaacaatgtgtctgcagcagttcagcctgctagtcataccatc
aagaattgtgatacacctttgcaacttcctcaaaatatatctaaaaaaattaaaaattct
gtagtacataagactatcaagcccaataaacatgcatcagaaattgatgaacaacaagaa
gttaaagagaatgttattcaaccatcaaataccttggagagtaaaaaatataacgttact
tggggcaaacaaacaaaaaagaagcacaaaacatgggaaggtgatggatacctaattgta
tctgataaatttgcagcacttcatgacttagatggtcacaaattaggttctaccagtgac
ttaaaatctttaaatttagaagatggttcaattattgttgttggtaataagcaagtccaa
gtattagatttagttacagaatttgatactgcagcgattgaaaaatcaactgttacttca
tgtgcagaacctctccgtaaacgaccaaaaatattagtagatgttagttctcctgaagca
ctaatcatgcctgaacctgatattgatcatcaatctttcttcaacaaaaaaaaagaagaa
atcacttcagttgtgcttgaaccttttttggcaaaacacctaagacctcatcaaaaaact
ggcatcattttcttgtatgaatgtgtttctggatttaaggctcaagaatgttttggtgct
attttggctgatgaaatgggtcttggcaagacattacaaactatttgtttggtttggatg
ttactgaagcgaggaccatatggaggtattccattggccaaaagagtattgatagttgct
cctagtagtcttgtaggaaattgggaaaatgaatttactaggtggttaggaagagataga
ctaaggctgttttctgtagatcaaaaaaaaaaaccctcagagtttgctagattacctgct
cggagttatcctgtaatgataacttcatatgaaatgttagtgcgttatattgaagaaatt
gaaaaactacattttgatttgatggtatgtgatgaaggccatcggttaaaaaataacagt
actaatacatatttagcattaacaaagatagaatgtaaacgaagagttttattgactggt
acaccaattcaaaatgagctagctgaattttatgcacttatagactttgttaatcctgga
atattgggaacatattcaatgttcaagcgtgagtttgaagataaaattgtggaatctcaa
caaccagaatgccatccacaaataatttcgctgggaaaacgaaaagcttcagaacttaat
gaagtaactgaaaaatttattttaagaaggactcaagatgttaacaacaaatatctacct
tctaaatacgaatctgtagtattctgtgcaatggctcctattcaatgccgtttatacgaa
gaaactgtttcatattgggaaaatcgtgtacaagaatttggtttgagtacaatttcacac
ttcagtgtcattactatgttgaaaaaagtttgcaaccatccagaattaatactgaacaac
cgcaataactccgatactactgaagagaccttaaatcaacatttgaatcgcactattact
ttaaaacactcattaatagaaagttcaggaaagcttatagttgttgacaacttattaaaa
gagttgcataaaaatggttccgaaaaaaccgttttgatatcatattatactcagacttta
gatatatttgttaagttatgtgatatgaaacattacaaatatttgagacttgatggatct
actgctactgctcaacgaactgatatagttaaaaaatttaataattcaaactctaattac
agtgttcttttattaagtgcaaaagcaggcggtgttggtttgaatcttgttggcgcatca
aatttaattttatatgactctgattggaatccagcttctgaccaacaagctatggctaga
atttggagagacggtcagaaaaaaaatgttcacatttataggttacttacaagtggtaca
atagaagaaaaaatatttcaaagacagattagtaagactggcctgagtgaagccattaca
aatcctgataatcaaaataatacaaaattgtcatttgaacaactaaaagacttatttaat
tttaaaaaagatgctttgtgctcaactcatgatttattggaatgtaattgtggtggaaaa
ggtgtagttcttagtgataatagtgcatttgaatgtgatgacaaaaaatctgaagcacca
ctaagagttaatgaacttatgaaatgggaacatcattcgtcacctttcaacacagatgtt
ttagaggccatgaacttatttggagtgtcaacaactatccgcttcttgtttagaaataaa
gcaaattaa

DBGET integrated database retrieval system