KEGG   Acyrthosiphon pisum (pea aphid): 100169623Help
Entry
100169623         CDS       T01076                                 

Definition
mRNA export factor
Orthology
K14298  
mRNA export factor
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:api00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100169623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 358 aa AA seqDB search
MLGGGLFSNKPVAAPTNPNKDFEVTQPPDDTVSAMAFSPATMQQNFLIAGSWDNSVRCWE
VEQSGKTVPKSMQSMTMPILDVCWSDDGTKVFMASCDKQVKCWDLGSNQTVQVAAHDAPI
KTCHWVKAPSYTCIMTGSWDKTLKFWDVRSPVPMMTINLPERAYCADVDYPMAVVGTASR
GIVVYKLEGKPEMVKSVDSPLKYQHRCVAIFRDKKKQSPTGFGLGSVEGRVAIHYIQPQS
SKDNFTFKCHRQNNSGTMNVQDIYAVNDIKFHPVHGTLATVGSDATFAYWDKDARTKLKS
SETLDQPITKCCFNSNGQIFAYSTGYDWSKGHEYNNPAKKPQIFLKPCFEDLKPKSSN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtggaggtttgttttccaataagccagtggctgcgcccacaaaccctaataaa
gattttgaagtcacacagcctcctgatgataccgtttcggcaatggcgttcagtccggct
acgatgcagcaaaacttcctcattgctggtagttgggataacagtgtacgttgttgggag
gttgaacagagcggcaagactgtgccaaaatccatgcagtcaatgacaatgccaatttta
gacgtatgttggagtgatgatggcacaaaagttttcatggcgtcttgtgacaaacaagta
aaatgctgggatttaggaagtaatcaaacagtgcaagtagcagctcacgatgcgcccatt
aagacttgtcattgggtcaaagcgccatcttatacttgtattatgacaggctcatgggat
aaaacattaaagttttgggatgttagaagtccagttcccatgatgaccattaatctacct
gagagagcttattgtgctgatgtggattatcctatggcagttgttggtacagcatcaagg
ggcatagttgtttataaactagaaggaaaacctgaaatggtgaaatctgtggactctcct
cttaaatatcaacatcgttgtgttgcaattttcagagataagaaaaaacaatcccctact
ggatttggtttgggaagtgttgaaggacgtgttgctattcactatatacaaccccagagt
tcaaaagacaactttacattcaaatgtcatcgtcaaaataactcaggaactatgaatgtc
caagacatttatgctgtgaatgatatcaagttccatccagtccatggtacattagcaact
gtgggttctgatgcaacgttcgcatattgggataaagacgcgcgtacaaagttgaagtca
tctgagacgcttgaccaaccaataacaaaatgctgttttaatagcaacggtcaaatattt
gcttacagtactggatatgactggtcaaaaggtcacgagtataataatcccgctaaaaaa
ccacagattttcttaaaaccatgcttcgaggatctaaaaccaaaaagtagtaattag

DBGET integrated database retrieval system