KEGG   Acyrthosiphon pisum (pea aphid): 100569276Help
Entry
100569276         CDS       T01076                                 

Definition
replication factor A protein 2-like
Orthology
K10739  
replication factor A2
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:api03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:api03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:api03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:api03440]
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:api03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 244 aa AA seqDB search
MWGDDEGGFNVTMTQSPTTASGVEPKQNTVISVAIRELFDSNEENKNTHVVVVGIIKQVK
PLFILXXXTGRLLCIQWGDENELSRYPKLIENAYFKVVGSKRMQNDKVTLLCHSVRPLET
LNELTHHLLSIIALPYITEEINVASGTQQSTATNQKDFLMSGDNTNGFMDTTNNLSLNPR
QLKVYTVIKRCQDEAGYSALDIQKILPEKMPLSEIEKILSFFIEEGHIFSTIDENHYKVT
DFGS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtggggtgacgatgaaggtgggtttaatgtcacaatgacgcaaagtccaacaacagca
tctggagttgaaccaaaacaaaatactgtaatctctgtagctattcgtgaattgtttgat
agtaacgaggaaaacaaaaatacacatgttgtagttgttggaattatcaagcaggtaaaa
ccactatttattttannnnnnnnnactggtcgtttgttgtgcattcaatggggagacgag
aacgaattgtcaagatatccaaagttgattgaaaacgcttattttaaagtagttggtagt
aagagaatgcaaaatgacaaagttactttgctttgtcatagtgtcagacctttagaaact
ctaaatgaattaacacatcatttattaagcattattgcgttaccatatataaccgaggaa
atcaatgtggctagcggtacacaacaatctactgcaacaaaccaaaaagactttttaatg
agtggtgataatactaatggatttatggatacaactaacaatttatcgctgaatccgagg
caattaaaagtttatacagtaataaagaggtgccaggatgaggcaggttattcagcatta
gatatacaaaagatacttccagagaaaatgccattatcagaaatagaaaaaattctttca
tttttcatcgaagagggacatattttctcaaccattgatgagaatcattacaaagtcact
gatttcggaagttaa

DBGET integrated database retrieval system