KEGG   Acyrthosiphon pisum (pea aphid): 100569479Help
Entry
100569479         CDS       T01076                                 

Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  
insulin receptor substrate 1
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin resistance
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100569479
   04150 mTOR signaling pathway
    100569479
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100569479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 916 aa AA seqDB search
MSSSMSSVCTFSPQNSKKSFKMSLLLAQLTDPPKPRNAMAGVVKIGYLKKNKNMRKKFFV
LREETAGGGPARLEYYETEKKWRNNAMPKKVIVLKSCFNIDKRVDARTKKTLICLYTKES
SFYIQFDTDKERDEWLDLMLVLQRVTKDFGPGVSLKEPFEHIWHISILKKELGMNANLIG
MTGLCLCDKKVSIMKYPTKSKEQKSMDIMLSSIRRCGALGTFFYMEVGQSSPLGSGHIWM
DTWNDDVAASVHETIMGASSRNHDLRFRMRSSSFNEGSRLINSNKEIYPIRQRSSCFYDE
NYPGLRYKNNSQSSSTLNNGNVDLARAGSGRERCDSMPLRPRTISENTTSSTRCFNGILS
PKQTFHKGCNCVSASSSLSAFNDSNLSTWDSSLSKSTDTTDGISSCYTSLNDHRSAILEE
KQEDFVPYTPLDKEEDSLRQTSDSNVNNNINLINNNIVGNKSSSSSQAGSCCDSNSPYGS
PINVDDTYIPFNPSGTSETSPPPDGYLPMKPGYTFSSNCLNVMPLEGHSNSKQEPTEMPQ
TEFESPEGYVPMAPVCRMSDYVSMDCKQGSIESGTPSTDTRFSDIHLDKVCAYLTPSEDE
GPIERPTRAYSVGSRPDGLREKIDKIYADRTRTRAFSVGSRGRLPPTGLPRNGYQSGSTS
MSEHSDSGDRMEIDFSCNSKSRRHYSATLRTLSNQPPADLSPRSSPKLCPSPDPSCTHRP
TGRSPPKSIVSSVDIKRTLSGAVHGISRSPPTSSHTYLSPTLERVSEVPGIELVDSYTPM
KPSQGLFPCENASMVVEESNKKNYVNVWEAASSTFPLMKMIGGLNWKKNKKRNTALEQLV
PMADEGIDEVDGYTTIKPGAHTIPVREQQIGQSSDAVLDAICDGLADIVFSDPSHIVTYN
SQNHSKSDNSVTSLDG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcgatgtcttcagtatgcaccttctcccctcaaaactccaagaaatcattt
aaaatgagcttgttattggcccaactgactgacccacctaagcctagaaatgctatggct
ggtgttgttaagattggatatttgaaaaaaaataagaatatgagaaaaaagttttttgta
cttcgtgaagagactgcaggtggtggacctgcacgcctcgagtattatgaaactgaaaaa
aaatggagaaacaatgcaatgcctaaaaaagtaattgtgttaaagtcgtgcttcaatata
gacaaacgcgtagatgcgcgtactaaaaagacactgatatgtttgtataccaaggaaagt
tccttttatatacaattcgatactgacaaagaacgtgacgagtggttggaccttatgtta
gttttacaacgagttactaaagattttggacctggtgtttcactcaaagaacctttcgag
catatttggcacatctctatactaaaaaaagagttgggaatgaatgcaaatttaataggc
atgactggactctgtttatgtgacaaaaaagtcagcataatgaaatatccaactaaatca
aaagaacaaaaatctatggatataatgttgtcaagtattcgtcgatgtggagctttgggt
acatttttttacatggaagtaggacaaagctctccattaggttctggtcatatatggatg
gatacatggaatgatgatgttgcagctagtgttcacgaaactataatgggggcatcaagt
cgaaatcatgatcttagatttagaatgagatcatcatcatttaatgaaggatcacgacta
ataaactccaataaagaaatatatccaataagacagcgctctagttgtttttatgatgag
aattaccctgggcttcggtataaaaataatagtcaaagttcctcaactttaaataatgga
aatgttgatttagctcgtgcaggatcaggtagggagcgttgtgatagcatgccattgcga
ccacgcactattagtgaaaacacaacttcatcaacgcgttgtttcaatggaattttatct
ccaaaacaaactttccacaaaggttgtaattgtgtttctgcatcttcgtcattatcagcg
tttaacgattctaacttgagtacctgggattcgtctctatcaaaatctacggataccaca
gatggaatctcttcgtgttatacgagtcttaatgaccaccgttctgcaatacttgaggaa
aaacaagaagattttgttccttacactccattggacaaagaagaagattctttgagacaa
acaagtgacagtaatgttaataataatattaacttaattaacaataatattgttggtaat
aaatccagttcctcttctcaggcgggttcttgttgtgattcaaatagtccatatggctca
cccatcaatgtagatgatacgtatattccttttaatccttctggtacgtctgaaacgtct
ccaccaccagatggatatcttccaatgaaaccaggatatactttttctagtaactgttta
aatgttatgccattggaaggacatagtaattctaaacaagaaccaactgaaatgcctcaa
acagaatttgaatcacctgaaggctatgttcctatggcacccgtttgtagaatgtctgat
tatgtgtctatggattgtaagcaaggatctattgaatctggtacaccttctacagacact
cgcttttctgacattcatctggataaagtgtgtgcataccttacgccatctgaggacgaa
ggacctattgaaaggcccactcgagcctattctgttggttccagaccagatggtttgaga
gagaaaattgacaaaatttatgctgatcgaacaagaacgcgtgcattttctgttggcagc
cgcggtcgattacccccaactgggttaccccggaatggatatcaatctggttcgaccagt
atgtctgaacatagtgatagtggcgatcgaatggaaatagattttagttgtaattcaaaa
tctcgtcgtcattattcggcaacattgcgcaccttgtctaatcagccaccagcagattta
tcaccaaggtcatcacctaaactttgtccttctcctgatccatcatgtactcatagacca
actggtcgttcccctccaaaatctatagtgtcttccgtagatattaaaaggacactatct
ggagctgttcatggtatttccagatcacctccaacatcttcacatacgtatttgtcacct
acgttggaaagagtttcagaggtgcctggtattgagcttgttgatagctacacaccaatg
aaaccgagccaaggattatttccctgtgaaaacgcaagtatggtggtagaagaatcaaat
aaaaaaaattatgtaaatgtgtgggaagcagcaagtagtacgtttccactcatgaaaatg
attggtggtttgaattggaaaaaaaacaaaaaacgtaacacagctctagaacaacttgtt
cccatggctgatgaaggcattgatgaagtagatggttatacgactattaagccaggtgct
catacaataccagtacgagaacaacagatcggtcagtcttctgatgccgtgttagatgcc
atttgtgatggacttgcggatatagtattctcagacccatctcatattgtcacatataat
tctcaaaaccactctaagtcagataactctgttacttcgctggatgggtaa

DBGET integrated database retrieval system