KEGG   Acyrthosiphon pisum (pea aphid): 100569479Help
Entry
100569479         CDS       T01076                                 

Definition
uncharacterized LOC100569479
Orthology
K16172  
insulin receptor substrate 1
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:api00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100569479
   04150 mTOR signaling pathway
    100569479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 916 aa AA seqDB search
MSSSMSSVCTFSPQNSKKSFKMSLLLAQLTDPPKPRNAMAGVVKIGYLKKNKNMRKKFFV
LREETAGGGPARLEYYETEKKWRNNAMPKKVIVLKSCFNIDKRVDARTKKTLICLYTKES
SFYIQFDTDKERDEWLDLMLVLQRVTKDFGPGVSLKEPFEHIWHISILKKELGMNANLIG
MTGLCLCDKKVSIMKYPTKSKEQKSMDIMLSSIRRCGALGTFFYMEVGQSSPLGSGHIWM
DTWNDDVAASVHETIMGASSRNHDLRFRMRSSSFNEGSRLINSNKEIYPIRQRSSCFYDE
NYPGLRYKNNSQSSSTLNNGNVDLARAGSGRERCDSMPLRPRTISENTTSSTRCFNGILS
PKQTFHKGCNCVSASSSLSAFNDSNLSTWDSSLSKSTDTTDGISSCYTSLNDHRSAILEE
KQEDFVPYTPLDKEEDSLRQTSDSNVNNNINLINNNIVGNKSSSSSQAGSCCDSNSPYGS
PINVDDTYIPFNPSGTSETSPPPDGYLPMKPGYTFSSNCLNVMPLEGHSNSKQEPTEMPQ
TEFESPEGYVPMAPVCRMSDYVSMDCKQGSIESGTPSTDTRFSDIHLDKVCAYLTPSEDE
GPIERPTRAYSVGSRPDGLREKIDKIYADRTRTRAFSVGSRGRLPPTGLPRNGYQSGSTS
MSEHSDSGDRMEIDFSCNSKSRRHYSATLRTLSNQPPADLSPRSSPKLCPSPDPSCTHRP
TGRSPPKSIVSSVDIKRTLSGAVHGISRSPPTSSHTYLSPTLERVSEVPGIELVDSYTPM
KPSQGLFPCENASMVVEESNKKNYVNVWEAASSTFPLMKMIGGLNWKKNKKRNTALEQLV
PMADEGIDEVDGYTTIKPGAHTIPVREQQIGQSSDAVLDAICDGLADIVFSDPSHIVTYN
SQNHSKSDNSVTSLDG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctcgatgtcttcagtatgcaccttctcccctcaaaactccaagaaatcattt
aaaatgagcttgttattggcccaactgactgacccacctaagcctagaaatgctatggct
ggtgttgttaagattggatatttgaaaaaaaataagaatatgagaaaaaagttttttgta
cttcgtgaagagactgcaggtggtggacctgcacgcctcgagtattatgaaactgaaaaa
aaatggagaaacaatgcaatgcctaaaaaagtaattgtgttaaagtcgtgcttcaatata
gacaaacgcgtagatgcgcgtactaaaaagacactgatatgtttgtataccaaggaaagt
tccttttatatacaattcgatactgacaaagaacgtgacgagtggttggaccttatgtta
gttttacaacgagttactaaagattttggacctggtgtttcactcaaagaacctttcgag
catatttggcacatctctatactaaaaaaagagttgggaatgaatgcaaatttaataggc
atgactggactctgtttatgtgacaaaaaagtcagcataatgaaatatccaactaaatca
aaagaacaaaaatctatggatataatgttgtcaagtattcgtcgatgtggagctttgggt
acatttttttacatggaagtaggacaaagctctccattaggttctggtcatatatggatg
gatacatggaatgatgatgttgcagctagtgttcacgaaactataatgggggcatcaagt
cgaaatcatgatcttagatttagaatgagatcatcatcatttaatgaaggatcacgacta
ataaactccaataaagaaatatatccaataagacagcgctctagttgtttttatgatgag
aattaccctgggcttcggtataaaaataatagtcaaagttcctcaactttaaataatgga
aatgttgatttagctcgtgcaggatcaggtagggagcgttgtgatagcatgccattgcga
ccacgcactattagtgaaaacacaacttcatcaacgcgttgtttcaatggaattttatct
ccaaaacaaactttccacaaaggttgtaattgtgtttctgcatcttcgtcattatcagcg
tttaacgattctaacttgagtacctgggattcgtctctatcaaaatctacggataccaca
gatggaatctcttcgtgttatacgagtcttaatgaccaccgttctgcaatacttgaggaa
aaacaagaagattttgttccttacactccattggacaaagaagaagattctttgagacaa
acaagtgacagtaatgttaataataatattaacttaattaacaataatattgttggtaat
aaatccagttcctcttctcaggcgggttcttgttgtgattcaaatagtccatatggctca
cccatcaatgtagatgatacgtatattccttttaatccttctggtacgtctgaaacgtct
ccaccaccagatggatatcttccaatgaaaccaggatatactttttctagtaactgttta
aatgttatgccattggaaggacatagtaattctaaacaagaaccaactgaaatgcctcaa
acagaatttgaatcacctgaaggctatgttcctatggcacccgtttgtagaatgtctgat
tatgtgtctatggattgtaagcaaggatctattgaatctggtacaccttctacagacact
cgcttttctgacattcatctggataaagtgtgtgcataccttacgccatctgaggacgaa
ggacctattgaaaggcccactcgagcctattctgttggttccagaccagatggtttgaga
gagaaaattgacaaaatttatgctgatcgaacaagaacgcgtgcattttctgttggcagc
cgcggtcgattacccccaactgggttaccccggaatggatatcaatctggttcgaccagt
atgtctgaacatagtgatagtggcgatcgaatggaaatagattttagttgtaattcaaaa
tctcgtcgtcattattcggcaacattgcgcaccttgtctaatcagccaccagcagattta
tcaccaaggtcatcacctaaactttgtccttctcctgatccatcatgtactcatagacca
actggtcgttcccctccaaaatctatagtgtcttccgtagatattaaaaggacactatct
ggagctgttcatggtatttccagatcacctccaacatcttcacatacgtatttgtcacct
acgttggaaagagtttcagaggtgcctggtattgagcttgttgatagctacacaccaatg
aaaccgagccaaggattatttccctgtgaaaacgcaagtatggtggtagaagaatcaaat
aaaaaaaattatgtaaatgtgtgggaagcagcaagtagtacgtttccactcatgaaaatg
attggtggtttgaattggaaaaaaaacaaaaaacgtaacacagctctagaacaacttgtt
cccatggctgatgaaggcattgatgaagtagatggttatacgactattaagccaggtgct
catacaataccagtacgagaacaacagatcggtcagtcttctgatgccgtgttagatgcc
atttgtgatggacttgcggatatagtattctcagacccatctcatattgtcacatataat
tctcaaaaccactctaagtcagataactctgttacttcgctggatgggtaa

DBGET integrated database retrieval system