KEGG   Acyrthosiphon pisum (pea aphid): 100570241Help
Entry
100570241         CDS       T01076                                 

Definition
membrane-bound alkaline phosphatase-like
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100570241
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100570241
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100570241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 235 aa AA seqDB search
MTYNDDCVTITCRGRTVILGGGRRHWLPKVAQDPEQPTDEGRRLDGRNLIDDWIRDKKKR
NIKAEYVWNNSQLDKIDAKNVDYLLGLFAYSHMEFEVDRDKGQNGDPPLSEMAVKALSIL
QKNNKGFFLFVESGRIDHAHHYNNPYRALEETLVLESTLEAIMSKVDLSDTLIVVTADHS
HVMTMGGLATPRGNDILVIFCLFVLLMATISLTGYHQPICAATASFQHIWLCSIC
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacgtataatgatgattgtgttactataacctgcagaggaaggacggtaatactgggc
ggtggccgaagacactggttaccaaaagtagcacaagatccagaacaacccaccgacgag
ggtagacgattggacggacggaatttgatagacgattggattagagacaaaaagaaacga
aacattaaagccgaatacgtatggaataatagtcagctggacaaaatcgatgcgaaaaat
gttgattatcttttaggtttgtttgcgtattcgcacatggagttcgaggtggaccgagac
aaaggacaaaacggcgacccacccctaagcgagatggccgtcaaagcgttatctatactc
cagaagaacaacaaaggattttttctgtttgtagaaagtggccgcatcgaccacgcgcat
cattacaacaatccttacagggcgttagaggaaacgcttgtgctggagtccacgctggaa
gccattatgtctaaggtagacttgtcagatacactcatcgttgtcacagcggatcattcg
catgtaatgacaatgggaggattggcaacccctcggggcaacgacatattggtgattttt
tgtctgtttgttctgctaatggctacaatttccttgaccggttatcatcagccgatctgt
gctgcaacagccagcttccaacatatttggttgtgttccatatgctaa

DBGET integrated database retrieval system