KEGG   Acyrthosiphon pisum (pea aphid): 100570439Help
Entry
100570439         CDS       T01076                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 475 aa AA seqDB search
RTCVREFTIFLMLSVVVVHLECSKIVHQNSVKRLENVFAGSNNGGYGPRILPPACPLERC
ANDKTSPPLEKLYNKVLKRKPGQLIPDRKNRNLLLDAFYQYFVLQFFDANSNFTVTASQL
YGSDDMSERSMRSFSGGKLKTSAINYKPFATKHAFAPYSDVYLTALTKDISIDRSWPSRM
NARLSERAEMLSTGTMFYVMSLLWAREHNWMCAELSQKWLTWTDEELYIKARKIVTRQMM
NIMMTEIQNVELRQEGYHHRMEYIRGSGNPFELHLTMAVSNVPEKLQCSSTNLTSYSNAS
QVSEAALNDSIQVMMSSKINVVTVNDDSTLTEQLTMTLSREQCLQRFNNYRRRIGLPAYK
NFFDITVNVEAPTEFEKLYSTMEKVELLTVVLTEKSISGVLPTEGTCVREFTIFLMLSVV
VVHLECSKIEKRVSFMSPIISLFHLGNSEVSRGRPTMWWSIFPFTSRFQLKTIYA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
aaagaacatgtgttagagaattcactatcttcttgatgttaagtgtggtggtagttcatc
tggaatgcagtaaaatagtccatcaaaattctgtgaaaagattagaaaatgtgttcgctg
gttccaacaacggtggatacggtcctagaatattgcctccagcttgtccactggaacgtt
gtgcgaatgacaaaacttcaccgccgctggaaaaactgtacaacaaagtcctcaaacgga
aacccggtcagttaataccggatcggaagaacagaaatttactgttggacgcgttctatc
aatatttcgttttgcaatttttcgacgcaaattcgaactttacggtaacggcttcccaat
tgtacggcagtgatgatatgtcggagagatcgatgagatcgttctccggtggtaagctca
agacaagcgcaattaattacaagccatttgcgacgaaacatgcgttcgcaccgtactcag
acgtatatttaacggcgttgacaaaagatatttcgatcgacaggtcgtggcccagcagaa
tgaacgcccgtctatccgaacgggccgagatgttgagcacgggcacaatgttttacgtaa
tgtcgctcctctgggcacgtgaacacaactggatgtgtgctgagctgtcacagaagtggc
tgacgtggacagacgaagagctgtatatcaaggccaggaagattgtaacccgtcaaatga
tgaacataatgatgaccgaaatccaaaatgtggaactcagacaggaagggtaccaccatc
gaatggaatacatccgtggttccggcaatccttttgaactgcacttgacgatggctgtat
caaatgtgccagaaaaattgcaatgcagttcaacgaatttgacgtcctacagtaacgcca
gtcaagtttcggaagctgctttaaatgactccattcaagtaatgatgagttcaaagataa
acgtggtcacggtcaacgatgacagcaccttgacggaacagcttaccatgacactctcga
gagaacaatgtttacagcgtttcaataactatagaagacggatagggctgcctgcttaca
aaaactttttcgatattaccgttaacgtcgaagccccaacggaattcgaaaaattgtata
gtaccatggagaaagtggagttgttaaccgtcgtgttgacggaaaaatccatttctggag
ttctaccaacagaaggaacatgtgttagagaattcactatcttcttgatgttaagtgtgg
tggtagttcatctggaatgcagtaaaatagaaaaacgcgtgtcgtttatgtcacctataa
tatcactgtttcaccttggaaactcggaagtcagtagaggcaggccgacgatgtggtgga
gcatttttccgttcacttcgagattccagctgaaaacaatttacgctc

DBGET integrated database retrieval system