KEGG   Acyrthosiphon pisum (pea aphid): 100571193Help
Entry
100571193         CDS       T01076                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100571193
Peptidases [BR:api01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100571193
Exosome [BR:api04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100571193
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 338 aa AA seqDB search
MFINCNKRKACGTTVGFFGIAFIIIFLLVPAIWRYSPSIQKRMIFLNHDHMPKVQNYSHP
EVYGLRGTRNFYIDTKDNVTLGVWHILPSNLFVKYGANESNYEQLLSHGESIIIYMHGNS
GARSNNQRIELYRKLRDINCHVIAVDYRSYADSTDVEIDETGLVSDAMETFKWVYERAHG
SPIFGWGHSLGTGIGAHAFSLLEKENIYPHGLILEAPFNKMSEAIREYSTTKVLRYFPWF
DFFIIDPVIENGIVFDTEQNLKNAKVPVLILHARDDIIIPYQLSENLYNYIKASRKSELT
ELILFDALYGFGHQFICRDNGIKKKIEKFIQNCLKTTS
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttattaactgcaataagagaaaggcgtgtggcacgacggtgggcttttttggtatc
gcattcatcatcattttcttacttgtacctgctatttggcgttattcaccttcaattcaa
aagaggatgatattcctgaatcatgaccatatgcctaaggtacagaattatagtcacccg
gaagtttatggtttgcgtggaacgagaaatttttacattgatacaaaagacaatgtaaca
ttaggagtgtggcatatattaccaagtaatttgtttgtaaaatacggagcaaacgaatct
aattacgaacaacttttgagtcacggggaatcgattatcatatacatgcatggcaactcc
ggtgcccgctcgaacaatcaacggatagaattgtatcgcaagctccgggatatcaactgt
cacgtgatagccgtagactatagaagttatgccgattctacagacgtcgaaatcgacgag
accggcttagtatcggatgcgatggagacatttaaatgggtttacgaacgcgcacatgga
tcgccaatatttggttggggacactctttgggcactggaattggagcacatgcgttttcg
ttattggaaaaagaaaacatctatcctcatggacttattttagaagctccattcaataaa
atgagtgaagcaattagagaatattcaactacaaaggttcttcgctatttcccttggttt
gattttttcattattgatccagttattgaaaatggaattgtttttgatacagaacaaaac
ttaaaaaacgcgaaagtcccagtgctgatattacatgctcgagatgatattataatacca
taccaactcagtgaaaacttgtataattacattaaagcaagtcggaaaagtgaactgact
gaactcattttgtttgacgccttgtatggctttggtcatcagtttatttgtcgggataat
ggaatcaaaaaaaaaattgagaaatttatacagaactgtctaaaaacgacgtcttga

DBGET integrated database retrieval system