KEGG   Acyrthosiphon pisum (pea aphid): 100571465Help
Entry
100571465         CDS       T01076                                 

Definition
(RefSeq) uncharacterized LOC100571465
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100571465
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100571465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 851 aa AA seqDB search
MYSKENGLSCWCTQNYVGEHCQKRVSFMSPIISMFRFGNSEVSKGRPTMWWSIFPFTSGP
QLKTIYDFHQNSVKRLENVFAGSNNGGYGPRILPSACPLECCANDKTSPPLGKLYNKVLK
RKPGQLIPDRKNRNLLLDAFYQYFVLQFFDANSNLTVTASQLYGSDDMSERSMRSFSGGK
LKTSAINYKPFATNHALAPYSDVYLTALTKDISIDRSWPSRMNARLSERAEMLSTGTMFY
VMSLLWAREHNWMCAELSQKWPTWTDEELYIKARKIVTRQMMNIMMTEIQNVELRQEGYH
HRMEYIRGSGNPFELHLTMAVSNVPEKLQCSSTNLTSYSNASQVSEAALNDSIQVMMSSK
INVVTVNDDSTLTEQLTMTLSREQCLQRFNNYRRRIGLPAYKNFFDITVNVEAPTEFEKL
YSTMEKVELLTVVLTEKSISGVLPTEGTCVREFTIFLMLSVVVVHLECSKIGKRVSFMSP
IISLFHLGNSEVSRGRPTMWWSIFPFTSRFQLKTIYALHQNSVKRLENVFAGSNNGGYGP
RILPPACPLERCANDITLPPLETLYNKILKPKPSQFITDRKNRNLLLDAFNQYFVFQFFD
PNSNLTVTASQLYGSDDMSERSMRSFYGSKLKTRAINYKHFATNHAFEPFSNVYLKVLIK
GIWFERSWPSRMNVRLFERAEILSTSTMSLLWARERNRLSQKWPTWTDEELYPKVRKILT
GQMMNIMMTEIRNVELRPEVYHHRMENFRGSDKTFKLYSTMAVSNMPEKLQCSSTNLTSY
SNASQVSEAALKDSIQLMMSPKISMVTANDVCPLEPMGKSSYANLWTKIVSFVSAIGIPI
LCRNVGNVNEL
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcaaggaaaatggattatcgtgctggtgcacccaaaactacgtcggcgaacac
tgccagaaacgcgtgtcgtttatgtcacctataatatcaatgtttcgctttggaaactcg
gaagtcagtaaaggcaggccgacgatgtggtggagcatttttccgttcacttcaggaccc
cagttgaaaaccatttacgatttccatcaaaattctgtgaaaagattagaaaatgtgttc
gctggttccaacaacggtggatacggtcccagaatattgccatcagcatgtccactggaa
tgttgtgcaaacgacaaaacttcaccgccgctgggaaaactgtacaacaaagtcctcaaa
cggaaacccggtcagttaataccggatcggaagaacagaaatttactgttggacgcgttc
tatcaatatttcgttttgcaatttttcgacgcaaattcgaacttgacggtaacggcttcc
caattgtacggcagtgatgatatgtcggagagatcgatgagatcgttctccggtggtaag
ctcaagacaagcgcaattaattacaagccatttgcgacgaaccatgcgctcgcaccatac
tcagacgtatatttaacggcgttgacaaaagatatttcgatcgacaggtcgtggcccagc
agaatgaacgcccgtctatccgaacgggccgagatgttgagcacgggcacaatgttttac
gtaatgtcgctcctctgggcacgtgaacacaactggatgtgtgctgagctgtcacagaag
tggccgacgtggacagacgaagagctgtatatcaaggccaggaagattgtaacccgtcaa
atgatgaacataatgatgaccgaaatccaaaatgtggaactcagacaggaagggtaccac
catcgaatggaatacatccgtggttccggcaatccttttgaactgcacttgacgatggct
gtatcaaatgtgccagaaaaattgcaatgcagttcaacgaatttgacgtcctacagtaac
gccagtcaagtttcggaagctgctttaaatgactccattcaagtaatgatgagttcaaag
ataaacgtggtcacggtcaacgatgacagcaccttgacggaacagcttaccatgacactc
tcgagagaacaatgtttacagcgtttcaataactatagaagacggatagggctgcctgct
tacaaaaactttttcgatattaccgttaacgtcgaagccccaacggaattcgaaaaattg
tatagtaccatggagaaagtggagttgttaaccgtcgtgttgacggaaaaatccatttct
ggagttctaccaacagaaggaacatgtgttagagaattcactatcttcttgatgttaagt
gtggtggtagttcatctggaatgcagtaaaataggaaaacgcgtgtcgtttatgtcacct
ataatatcactgtttcaccttggaaactcggaagtcagtagaggcaggccgacgatgtgg
tggagcatttttccgttcacttcgagattccagctgaaaacaatttacgctctccatcaa
aattctgtgaaaagattagaaaacgtgttcgctggttccaacaacggtggatacggtcct
agaatattgcctccagcttgtccactggaacgttgtgcgaacgacataactttaccgccg
ctggaaacactgtacaacaaaatcctcaaaccgaaacccagtcagttcataacggatcgg
aagaacagaaatttattgttggacgcgttcaatcaatatttcgttttccaatttttcgac
ccaaattcgaacttgacggtaacggcttcccaattgtacggcagtgatgatatgtcggag
agatcgatgagatcgttctacggcagtaagctcaaaacaagagcaattaattacaaacat
tttgcgacgaaccatgcgttcgaaccattctcaaacgtatatttaaaggtgttgataaaa
ggcatttggttcgaaagatcgtggcccagcagaatgaatgtccggctattcgaacgggcc
gagattttgagcaccagtacaatgtcactcctctgggcacgtgaacgcaaccgactgtca
cagaagtggccgacgtggacagacgaagagctgtatcccaaggtcaggaagattttaacc
ggtcaaatgatgaacataatgatgaccgaaatccgaaatgtggaactcagaccggaagtg
taccaccatcgaatggaaaacttccgtggttccgacaaaacttttaaactgtactcgacg
atggctgtatcaaatatgccagaaaaattgcaatgcagttcaacgaatttgacgtcctac
agtaacgccagtcaagtttcggaagctgctttaaaagactccattcaattaatgatgagt
ccaaagataagcatggtcacggccaacgatgtctgccccttggaaccaatgggaaaatct
tcatatgcaaatctttggacgaaaatcgtcagttttgtgtcagccatcggtatacccata
ttgtgtcgaaacgtgggcaacgtcaatgagctataa

DBGET integrated database retrieval system