KEGG   Acyrthosiphon pisum (pea aphid): 100571465Help
Entry
100571465         CDS       T01076                                 

Definition
(RefSeq) uncharacterized LOC100571465
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 851 aa AA seqDB search
MYSKENGLSCWCTQNYVGEHCQKRVSFMSPIISMFRFGNSEVSKGRPTMWWSIFPFTSGP
QLKTIYDFHQNSVKRLENVFAGSNNGGYGPRILPSACPLECCANDKTSPPLGKLYNKVLK
RKPGQLIPDRKNRNLLLDAFYQYFVLQFFDANSNLTVTASQLYGSDDMSERSMRSFSGGK
LKTSAINYKPFATNHALAPYSDVYLTALTKDISIDRSWPSRMNARLSERAEMLSTGTMFY
VMSLLWAREHNWMCAELSQKWPTWTDEELYIKARKIVTRQMMNIMMTEIQNVELRQEGYH
HRMEYIRGSGNPFELHLTMAVSNVPEKLQCSSTNLTSYSNASQVSEAALNDSIQVMMSSK
INVVTVNDDSTLTEQLTMTLSREQCLQRFNNYRRRIGLPAYKNFFDITVNVEAPTEFEKL
YSTMEKVELLTVVLTEKSISGVLPTEGTCVREFTIFLMLSVVVVHLECSKIGKRVSFMSP
IISLFHLGNSEVSRGRPTMWWSIFPFTSRFQLKTIYALHQNSVKRLENVFAGSNNGGYGP
RILPPACPLERCANDITLPPLETLYNKILKPKPSQFITDRKNRNLLLDAFNQYFVFQFFD
PNSNLTVTASQLYGSDDMSERSMRSFYGSKLKTRAINYKHFATNHAFEPFSNVYLKVLIK
GIWFERSWPSRMNVRLFERAEILSTSTMSLLWARERNRLSQKWPTWTDEELYPKVRKILT
GQMMNIMMTEIRNVELRPEVYHHRMENFRGSDKTFKLYSTMAVSNMPEKLQCSSTNLTSY
SNASQVSEAALKDSIQLMMSPKISMVTANDVCPLEPMGKSSYANLWTKIVSFVSAIGIPI
LCRNVGNVNEL
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgtacagcaaggaaaatggattatcgtgctggtgcacccaaaactacgtcggcgaacac
tgccagaaacgcgtgtcgtttatgtcacctataatatcaatgtttcgctttggaaactcg
gaagtcagtaaaggcaggccgacgatgtggtggagcatttttccgttcacttcaggaccc
cagttgaaaaccatttacgatttccatcaaaattctgtgaaaagattagaaaatgtgttc
gctggttccaacaacggtggatacggtcccagaatattgccatcagcatgtccactggaa
tgttgtgcaaacgacaaaacttcaccgccgctgggaaaactgtacaacaaagtcctcaaa
cggaaacccggtcagttaataccggatcggaagaacagaaatttactgttggacgcgttc
tatcaatatttcgttttgcaatttttcgacgcaaattcgaacttgacggtaacggcttcc
caattgtacggcagtgatgatatgtcggagagatcgatgagatcgttctccggtggtaag
ctcaagacaagcgcaattaattacaagccatttgcgacgaaccatgcgctcgcaccatac
tcagacgtatatttaacggcgttgacaaaagatatttcgatcgacaggtcgtggcccagc
agaatgaacgcccgtctatccgaacgggccgagatgttgagcacgggcacaatgttttac
gtaatgtcgctcctctgggcacgtgaacacaactggatgtgtgctgagctgtcacagaag
tggccgacgtggacagacgaagagctgtatatcaaggccaggaagattgtaacccgtcaa
atgatgaacataatgatgaccgaaatccaaaatgtggaactcagacaggaagggtaccac
catcgaatggaatacatccgtggttccggcaatccttttgaactgcacttgacgatggct
gtatcaaatgtgccagaaaaattgcaatgcagttcaacgaatttgacgtcctacagtaac
gccagtcaagtttcggaagctgctttaaatgactccattcaagtaatgatgagttcaaag
ataaacgtggtcacggtcaacgatgacagcaccttgacggaacagcttaccatgacactc
tcgagagaacaatgtttacagcgtttcaataactatagaagacggatagggctgcctgct
tacaaaaactttttcgatattaccgttaacgtcgaagccccaacggaattcgaaaaattg
tatagtaccatggagaaagtggagttgttaaccgtcgtgttgacggaaaaatccatttct
ggagttctaccaacagaaggaacatgtgttagagaattcactatcttcttgatgttaagt
gtggtggtagttcatctggaatgcagtaaaataggaaaacgcgtgtcgtttatgtcacct
ataatatcactgtttcaccttggaaactcggaagtcagtagaggcaggccgacgatgtgg
tggagcatttttccgttcacttcgagattccagctgaaaacaatttacgctctccatcaa
aattctgtgaaaagattagaaaacgtgttcgctggttccaacaacggtggatacggtcct
agaatattgcctccagcttgtccactggaacgttgtgcgaacgacataactttaccgccg
ctggaaacactgtacaacaaaatcctcaaaccgaaacccagtcagttcataacggatcgg
aagaacagaaatttattgttggacgcgttcaatcaatatttcgttttccaatttttcgac
ccaaattcgaacttgacggtaacggcttcccaattgtacggcagtgatgatatgtcggag
agatcgatgagatcgttctacggcagtaagctcaaaacaagagcaattaattacaaacat
tttgcgacgaaccatgcgttcgaaccattctcaaacgtatatttaaaggtgttgataaaa
ggcatttggttcgaaagatcgtggcccagcagaatgaatgtccggctattcgaacgggcc
gagattttgagcaccagtacaatgtcactcctctgggcacgtgaacgcaaccgactgtca
cagaagtggccgacgtggacagacgaagagctgtatcccaaggtcaggaagattttaacc
ggtcaaatgatgaacataatgatgaccgaaatccgaaatgtggaactcagaccggaagtg
taccaccatcgaatggaaaacttccgtggttccgacaaaacttttaaactgtactcgacg
atggctgtatcaaatatgccagaaaaattgcaatgcagttcaacgaatttgacgtcctac
agtaacgccagtcaagtttcggaagctgctttaaaagactccattcaattaatgatgagt
ccaaagataagcatggtcacggccaacgatgtctgccccttggaaccaatgggaaaatct
tcatatgcaaatctttggacgaaaatcgtcagttttgtgtcagccatcggtatacccata
ttgtgtcgaaacgtgggcaacgtcaatgagctataa

DBGET integrated database retrieval system