KEGG   Acyrthosiphon pisum (pea aphid): 100572106Help
Entry
100572106         CDS       T01076                                 

Definition
(RefSeq) beta-hexosaminidase subunit beta-like
  KO
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo and isoglobo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100572106
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100572106
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100572106
   00604 Glycosphingolipid biosynthesis - ganglio series
    100572106
   00511 Other glycan degradation
    100572106
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100572106
Enzymes [BR:api01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100572106
Chaperones and folding catalysts [BR:api03110]
 Intramolecular chaperones
  Others
   100572106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 527 aa AA seqDB search
MHYNNLITNSFVVCSILLFSIPQSFNQNVGPTVKMTNGQVWPKPVLQHIYDEYLTFEPEN
FHFNITGYSCDDLQDAFKRYNSMLFLKATKKFNQNTSLSTDLIIGKMEVLNVQMTNPCEN
YPSLNMDEKYEIKINNSSGLLLASSIWGILRGLETFSQLIYLETDGSTFVIRRTSIVDYP
KFRHRGFLLDTSRHYFPIESITKTLDAMSYSKMNVFHWHIVDDQSFPYQSSAFPNLSERG
AFGKSAIYTKDDVKRVIEHAKLRGIRVIPEFDTPGHSLSWGLGGIPGLLTECSDPNEFGP
IDPTVEENYNFIRTLFSEISELFQDNYLHLGGDEVDNSCWFTNKKVQNFMHRNNIKNVVE
LKDYYFANIFNITRSLKTVPIVWEEIFDDNIHLDPNAVVHVWKNYYDYSILSKIMESGHP
ALFSSCWYLNYIKYGADWSNFYRCDPTSEVGDNSLFLGGEACMWGEFVDETNLLPRTWPR
TSAVAEVLWSYTLNETDAKYRIEEHVCRMRRRGIPAQPANGPSYCHY
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcattataataatcttattaccaattcattcgttgtttgttctattctcttattctcc
ataccacaatcattcaaccaaaatgtgggaccaactgtaaaaatgaccaatggacaagtg
tggccgaaacctgtgctgcaacacatctacgatgaatatttgacatttgaaccagaaaat
tttcatttcaatattacaggttatagttgtgacgaccttcaagatgcatttaaacggtat
aattctatgctgtttttaaaggctacgaaaaaatttaatcaaaacactagtttatctacg
gacttaatcattggcaagatggaagtgctcaatgtgcagatgacaaatccctgtgagaat
tatccttcgttaaatatggacgaaaaatatgaaattaaaataaacaattccagtggactt
ttacttgcatcgtctatttggggcattctcagaggtctagaaacattttctcagttgatt
tatttggaaacggacggttccacgtttgtgattcggcgcacgtcaatagtggactatccg
aaattcaggcatcgtggatttctattagatacgtctcgtcattatttccctatcgaatcg
atcacgaaaactctagacgccatgtcgtattcgaaaatgaacgtgtttcactggcacata
gtagacgaccagagcttcccgtatcagagcagcgcttttccgaacctgagcgaaagagga
gctttcgggaaatcggcaatttatacgaaagatgacgtcaaacgtgtgatcgaacacgca
aaacttcgaggtattcgtgttattccagaattcgacaccccaggacattcgttatcttgg
ggactcggtggtattccgggactactaactgagtgttcggatccaaatgaatttgggcct
atcgacccgacggtcgaggaaaactacaattttatcaggacgctattttctgaaatcagc
gaattattccaagacaattatttacacctcggtggcgacgaagtagataattcgtgctgg
ttcacgaacaaaaaggtacaaaactttatgcatcgtaataacataaagaacgtcgtcgaa
ttaaaagactactacttcgcaaacattttcaacataacgcgaagtttaaaaaccgtgccc
atcgtgtgggaagaaatatttgacgacaacatccacctcgatcccaacgccgtggtccat
gtgtggaagaactattatgattattcgatcttgtcgaagataatggaaagcggacatccg
gcactattttccagttgctggtacttgaactacatcaagtacggagcggactggtcgaac
ttctacaggtgcgacccgacctccgaggtcggcgataacagtttgtttttgggaggcgag
gcgtgcatgtggggcgagttcgtggacgaaacgaacttattgccacgcacgtggcccagg
accagcgccgtggccgaagtgctgtggtcatacacgctaaacgagactgacgccaagtac
aggatcgaggaacacgtttgcaggatgaggcggagaggaatacccgctcagccagcaaac
ggacctagctattgtcattactag

DBGET integrated database retrieval system