KEGG   Acyrthosiphon pisum (pea aphid): 100572983Help
Entry
100572983         CDS       T01076                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100572983
Enzymes [BR:api01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     100572983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 254 aa AA seqDB search
MSRSKSNTTFIIFKAYSEENEPIDPYITILKNQGYKTQLVPTLEFEYHNFDALNQKLQKP
QDYSGMVITSPRCARGIIQSLAGSKLDENWKKKPIFVVGESTARLINKELGLEPIGADSG
NATALIPTILKYELSKPLLAPCGNLNINILSNSIKSVKFENIEVYRTIPHNNLKTNLNLV
LNQIKDQIGVIFFSPSGFRAILDLMPKKLFSQLHIFAIGPTTGAAIKEAGYILTGACEKP
KPESLLEMIQSFIK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttctaaatctaatacaactttcataatttttaaagcttattcagaagaaaat
gagccaatagatccatacataactattttaaaaaatcagggatataaaactcagttagtc
cccactttagaatttgaatatcataactttgatgcgcttaatcagaaactacaaaagcca
caagattattctggtatggtaataactagtccaagatgtgcaagaggaatcatccagagt
ttggccggtagtaagctagatgaaaattggaaaaaaaaacctatatttgttgtaggagaa
tcaacagctcggctaataaacaaagaactcggtcttgagccaattggggctgatagtggc
aatgctacggctttaatacctactattttaaaatatgaattaagtaaaccattattagct
ccatgtggaaatctaaacattaatatactatcgaatagtataaaatctgttaaatttgag
aatatagaagtttaccgaactataccacataataatttaaagacaaatttaaatttggtg
ttgaatcaaattaaagaccaaataggtgttattttttttagtccttctggttttcgtgca
atattagatttgatgccaaaaaaattatttagtcaattacatatttttgctattggtcct
accacaggtgctgctattaaggaagctggttatattttaactggggcatgtgaaaaacca
aaaccagagtctttgttagagatgatacagtcatttattaaataa

DBGET integrated database retrieval system