KEGG   Acyrthosiphon pisum (pea aphid): 100572983Help
Entry
100572983         CDS       T01076                                 

Definition
uroporphyrinogen-III synthase-like
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:api00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 254 aa AA seqDB search
MSRSKSNTTFIIFKAYSEENEPIDPYITILKNQGYKTQLVPTLEFEYHNFDALNQKLQKP
QDYSGMVITSPRCARGIIQSLAGSKLDENWKKKPIFVVGESTARLINKELGLEPIGADSG
NATALIPTILKYELSKPLLAPCGNLNINILSNSIKSVKFENIEVYRTIPHNNLKTNLNLV
LNQIKDQIGVIFFSPSGFRAILDLMPKKLFSQLHIFAIGPTTGAAIKEAGYILTGACEKP
KPESLLEMIQSFIK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgttctaaatctaatacaactttcataatttttaaagcttattcagaagaaaat
gagccaatagatccatacataactattttaaaaaatcagggatataaaactcagttagtc
cccactttagaatttgaatatcataactttgatgcgcttaatcagaaactacaaaagcca
caagattattctggtatggtaataactagtccaagatgtgcaagaggaatcatccagagt
ttggccggtagtaagctagatgaaaattggaaaaaaaaacctatatttgttgtaggagaa
tcaacagctcggctaataaacaaagaactcggtcttgagccaattggggctgatagtggc
aatgctacggctttaatacctactattttaaaatatgaattaagtaaaccattattagct
ccatgtggaaatctaaacattaatatactatcgaatagtataaaatctgttaaatttgag
aatatagaagtttaccgaactataccacataataatttaaagacaaatttaaatttggtg
ttgaatcaaattaaagaccaaataggtgttattttttttagtccttctggttttcgtgca
atattagatttgatgccaaaaaaattatttagtcaattacatatttttgctattggtcct
accacaggtgctgctattaaggaagctggttatattttaactggggcatgtgaaaaacca
aaaccagagtctttgttagagatgatacagtcatttattaaataa

DBGET integrated database retrieval system