KEGG   Acyrthosiphon pisum (pea aphid): 100573227Help
Entry
100573227         CDS       T01076                                 

Definition
histone-lysine N-methyltransferase SETD1B-A-like
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100573227
Enzymes [BR:api01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100573227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1315 aa AA seqDB search
MESYRKYSSRHHDSSHHNRHHRHRHRHHHYRYDQEEYESHRAHQRHHNNRSSDEDSEYEH
NRIPSTRVEKPPSPMYHQPTRRPTTPPPPPPPPTVSIIEKPKERNWKLLVDPFLTKAVSK
IYRYDGVLDPSLPELPNDDPRKTFKTITLPIDLPVPKFKLDRNYIGQRPEVEVTFSNLND
NIDKVFLTDLIVKFGKIELLQIFYHPVTKKHLGLAKIIFEEASSARYCVQRLNDTSVMGK
VVNVFLDPFASECKVMFDKMTEEKPKPLSEVPKVKPFPISNRDRRSVKSCKSKEESSVKP
QLEEKSSLPPKTDNYKTYSYDYTTPSPAVNDLPSEQSYSGGYNSIAGTPAYNETHPYSFN
RFPSSVPPVSNNYWWGESSRIPPPLPSAPAPIPVPAPAPTSKLDSEAQSKLDLDTRIEMM
LSGMSSQGASVEPAFLSIVKKEPDDVSFNIVEDTIDDDISLNLPPPPGDNDNQSDLDEEK
VSNDDETLPPLSNPPSPFLSKEVYIKCFENAAEQLKITREKEKLEAKSFLNNTIRNVINK
NMHDSLHSDISSSDDEFMLGLSPKGNTPDDAMSLSSLSSRDEKIVENDPNIPPQYPPLPN
YPPQGYYYPSQFNNHYGYQYFPYPPNYPYGPPLPRTEFYEPELPRDRHENENFPAELKKN
LMNAVLYELRIIIKLDLMKKMGTAVAFNALDQWWEEAERQSKSTSMTNEEPKSSQPAPNL
NSILEAGTEGLETLALSGLGLGFRAAIPKMPSFRRKKKEPSPKKTNEQQDYGSDQEEMVI
TSDNEAKDIDDDEVTRPTFAERKRLGRDLFDSDSNSSTSEPSVHSSSEEESSNDSSSNEG
SSDEFIWKNKLKKLCKTMTMDDFDRVRELTPTGNETPVEMDTLPSSDEEGSFVKYKRDDK
AVKRKIDDEHLDKEVEPKKRLLNGEETPSEVFSDNLYCVAKQVYSPPPISDWETEVNKND
KSKNVIIQPVINEQKITEVFPKKLKQPLTVRDNNKIENTDQLIVQKHCDNQVKTKYYNKR
DMVQEATVLFEFLTKGIDVEDINYLKQSYDSLLSNDTVHYWTNETHWVSHPVTALPNQLP
RKKKKDEWKVHDTGCGRTEGYYKVDSKQKANHKYHFGHTIAQLNRITELKRVKESTGKML
ALSREARSNQRRLLTAYGATSDSDLLKFNVLKFRKKQLKFGKSAIHDWGLFAMESIAADE
MVIEYVGQMVRPVVADLRERQYEATGIGSSYLFRIDLDTIIDATKCGNLARFINHSCNPN
CYAKIIQIDGQKKIVIYSKQPIGVNEEITYDYKFPLEDNKIPCLCGTHCCRGTLN
NT seq 3948 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgtaccgtaaatatagttcgagacatcacgactccagtcaccacaacaggcac
cacagacatcgacaccgccatcatcactatagatacgatcaagaagagtatgaatcgcat
cgtgctcaccagcgacatcacaacaacagaagcagtgatgaagatagtgaatatgagcat
aacagaattccatctacaagagtggagaaacctccttcaccaatgtaccatcaaccaact
cgaaggccaactactccgccgcctccaccaccaccaccaacagtatcaattattgaaaag
ccaaaagaacgcaattggaaacttttggtcgatccatttcttactaaagcggtctctaaa
atatatcgctacgatggtgttttagatccctcgttacctgaattgcccaatgacgatcca
cgaaaaacatttaaaactattactttgcccattgatttgccagtacctaaatttaagctt
gacagaaactacattggccaacgtcctgaagtcgaagtaactttttccaatttaaacgat
aatattgataaagtgtttctgactgacttgatagtgaaatttggaaaaattgaattgtta
caaatattctaccacccagtcactaaaaaacatttgggtttagccaaaattatttttgaa
gaggcatcatcagctagatactgtgttcaaaggttaaatgatacatctgtgatgggaaaa
gttgtcaatgtatttttggacccttttgcctcagaatgtaaagtaatgtttgataagatg
actgaagaaaaaccaaaacctctatcagaagtaccaaaagttaaaccatttcctatttct
aatcgggatcgacggtcagttaaatcgtgtaaatccaaagaagaatcttctgttaaacct
cagttagaagagaaatcatcattgccacccaaaacagataattacaaaacttatagttat
gactataccacaccttctccagccgttaatgaccttccatcagagcaaagttatagcggt
ggatataacagtattgctggtactcctgcatacaatgagactcatccttattcctttaat
agatttcctagcagtgttcctccagtatcaaataattattggtggggagaatctagtcgt
atacctccacctttaccctcagcaccagcaccaataccggtacctgcaccagcaccaacc
tctaagttagattctgaagcacaatcaaaattggatttagatacaagaattgaaatgatg
cttagtggcatgtcttctcaaggtgctagtgtagaacctgcatttttatctattgttaaa
aaagagcctgatgatgtttcatttaacattgtggaagataccattgatgatgatattagt
ctgaatcttccaccgccacctggggataatgacaatcaatctgacttagatgaagaaaaa
gttagcaacgatgacgaaacgttacctccactttctaatcctccgtctcctttcttgtca
aaagaagtttacattaagtgttttgaaaatgcagccgaacaattaaaaattactagagaa
aaggagaaattggaagcaaaaagcttcttgaataatactataagaaatgttattaataag
aatatgcacgattctttgcacagtgatatcagctccagtgacgatgaattcatgttaggg
ttaagtcctaaaggaaatactcctgatgatgctatgagtttatctagtttgtcatcacgc
gatgagaaaatagttgaaaatgatcctaatataccaccacaatatccaccattgccaaat
tatcctcctcaaggatattattatccttcacaatttaacaatcattatggctatcaatat
tttccatatcctcctaattatccatatggtcctccattacctagaactgagttttatgaa
ccagaactaccacgtgataggcatgaaaatgaaaatttccctgcagaacttaaaaaaaat
ttaatgaatgcagtattatatgagttaagaattattattaaacttgaccttatgaagaaa
atggggacagctgtggcttttaatgccctggatcagtggtgggaagaagcggaaaggcag
tcaaaatctactagtatgactaacgaagagcctaaatcctcacaaccagctccaaacctt
aatagtatcttggaagctggtacagaaggcttagaaacgttggctctaagtggattaggt
ttagggttccgagcagctattcctaaaatgccatcattccgtagaaaaaagaaagaacca
tcacctaagaaaactaatgaacaacaagattacggaagtgatcaagaagaaatggttata
acttcagacaatgaagccaaagatattgatgatgatgaagtgactagacctacatttgcg
gaacgaaaacgtttgggaagagacctatttgacagtgatagtaattcttctacttctgaa
ccatcagttcatagttcttctgaggaagaatctagtaatgatagctctagtaatgagggt
tcatctgacgaattcatctggaaaaataaattgaaaaaattatgtaaaacaatgacaatg
gatgattttgatagggtcagggagctcacccctactggaaatgaaactcctgtggaaatg
gatactttaccaagttctgatgaagaaggatcatttgtgaaatataaacgtgatgataaa
gctgtgaaacgaaagattgatgatgagcatttagacaaagaagttgaacctaaaaaacgt
ttacttaatggagaagaaaccccgagtgaagtattttcagataatttgtattgtgtggca
aaacaggtatacagtcctcctcctatatctgattgggaaactgaagtcaacaaaaatgat
aaatctaagaatgtaataattcaaccagtaataaatgaacagaaaataacagaagttttt
ccaaaaaaattaaaacagcccttaactgtcagagataacaataaaatagaaaacacagat
cagttaattgtacaaaaacattgtgataaccaagttaaaactaaatattacaacaaacga
gatatggtacaagaagcaactgtattatttgagttccttactaagggtatagatgtggaa
gatattaactatttaaaacaaagctatgattcattgttgtccaatgatactgtacactac
tggacgaatgaaacacattgggtcagccatccagtgactgcattaccaaatcagcttccc
cgcaaaaagaaaaaagatgaatggaaagttcatgatacgggatgtggtagaactgaaggt
tattataaagtggacagtaaacaaaaagccaaccataagtatcattttggacacacaatt
gcgcaattaaaccgtattacagagcttaaacgtgtaaaagaatctactggtaaaatgtta
gctctttctcgtgaagctcggagtaaccagagaaggttattaacagcgtatggagccacg
tcagacagtgatttgctcaaattcaatgtgttaaagttccgtaagaaacaattgaaattc
ggaaaatctgctatacacgattggggtttgtttgctatggagtctattgcagctgatgaa
atggtcattgagtatgtaggccaaatggttcgccctgtagttgctgatctacgcgaaaga
caatatgaagctactggaataggtagttcgtatctattcagaatagatttggataccatt
attgatgctaccaaatgtggtaatctggcaagattcataaatcatagttgtaatcctaat
tgctatgccaagataattcaaatcgatggacaaaaaaaaatagtcatatatagtaaacag
ccaatcggagtaaatgaggaaataacttatgattataaattcccactcgaagataacaaa
ataccatgtctttgtggtacccattgttgccgtggaacgctcaactag

DBGET integrated database retrieval system