KEGG   Acyrthosiphon pisum (pea aphid): 100574163Help
Entry
100574163         CDS       T01076                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:api00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100574163
Enzymes [BR:api01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100574163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 544 aa AA seqDB search
MLSKENGVSCWCTPNYVGEHCQTKGRNLWNINLKCEHFKCENGGIRMLSKENGVSCWCTP
HYVGEHCQTIVEKPVSFMSPIISLFSHKNSDVSRGRPTMWWSIFPFTSGLQLETVYDFHQ
NAVKRLVNVSAGAENNGYTARILPPAWPITYLRPLNKYLENLPQLGTLYNGIFKRKPGRF
IPDQNNRNLLYNNAFYQYFVLQFLDGNSNLTVTASQLYGSDPVSERSMRSFYGGKLKTLK
FNYNHYVPNQKFRLPLNVFLNVVWYYKYTIKELIRKIAWKFKRAEMLSTSHLISEMSTLW
VREHNRVCDELSRKSPSWTDEQLYTTARKVVTGQMMTIMMKEILNVELRPEVNHHRMENI
SGSGTPIELYLTMAVSSLPENQQVSEAGLKDALKFMGNSKIGMFTAHNDDALTEYLTRTL
MTISREHCIQGFNNYRRLLGLPAYNSFFDLTGNNETATELKNLYSTVEDVELLTGVLTER
SISGVLPTAKVLSNSFVITAILTNNITAKHSWVPDTFGDVELFNLVKSASLKSLVYRNVD
VNRD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcaaggaaaatggagtctcatgctggtgcacaccaaactacgtcggtgaacac
tgccagacaaagggaagaaatttatggaacataaatcttaagtgcgaacattttaaatgt
gaaaatgggggtattagaatgttaagcaaggaaaatggagtctcatgctggtgcacacca
cactacgtcggtgaacactgccagacaatcgtagagaaacccgtgtcttttatgtcacct
ataatatcactgtttagccataagaattcagacgtgagtagaggcaggccgacgatgtgg
tggagcatatttccgttcacttctggactccagctggaaaccgtttacgatttccatcaa
aatgcggtgaaaagattagtaaacgtgtccgctggtgccgaaaacaatggatacaccgca
agaatattgcctcccgcatggccgataacatacttaaggcccctcaataaatatttagaa
aatttaccacagttgggtacgttgtacaatggcatcttcaaacggaaacccggtcggttc
ataccggatcagaataacagaaatttactatacaacaacgcattctatcaatatttcgtt
ttgcaatttttagatggaaattccaacttgacggtaacggcttctcaattgtacggcagt
gatcctgtgtcggagagatcgatgagatcgttctacggcggtaagctcaagacactgaaa
tttaattacaatcattatgtgccgaaccagaagttcagactacccttaaacgtattctta
aatgttgtgtggtattataaatacactataaaagagctcatcagaaagatcgcctggaaa
tttaaacgggccgagatgttgagcacgagccatttaatatctgaaatgtcgacgctttgg
gtacgtgaacataatcgagtgtgcgacgagttgtcacggaagtcaccgtcgtggacggac
gaacaactatacaccacggccagaaaggttgtgaccggtcaaatgatgaccatcatgatg
aaggaaatcctaaatgtggaactcagaccggaagtaaaccaccaccgaatggaaaacatc
agtggttccggcacgcctattgaactgtatttgacgatggctgtatcaagtctgccggaa
aaccaacaagtttcggaagctggcttaaaagacgccctgaaatttatggggaattcaaag
atcggcatgttcacagcccacaacgacgatgccttgacggaataccttacaaggacacta
atgacaatctcgagagaacattgtatacagggttttaataactacagaaggctgttaggg
ctgcctgcttacaatagttttttcgatctgaccggaaacaatgaaaccgcaactgaattg
aaaaatctgtatagcaccgtggaagacgtggagttgttaaccggcgtattgacggaaaga
tccatttccggagttctacccacagccaaagtcttgtcgaatagttttgtcattaccgca
atcttgacaaataatatcaccgccaaacactcgtgggtaccagacacgttcggtgatgta
gaattatttaatttagttaagtcagctagtttaaagtcattggtgtatcgtaacgtagac
gtgaatcgtgactag

DBGET integrated database retrieval system