KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0014Help
Entry
APJL_0014         CDS       T00644                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apj00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:apj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13418..14920
Genome map
AA seq 500 aa AA seqDB search
MKRLLPFLTELDAWVTELKPLKQMTLDSRQVDEGDLFVALKGHQVDGRRFIQKAIEQGAA
LVLAEADEGQDEIELDAKFAKYNLDRTACKVVLVPNLARILSEIAGAFYANPSEKLTLVG
VTGTNGKTTSAQLLAQWHNLLGGKSAVMGTIGNGLYGKVQEAANTTGSAIEVQRNLADFV
EMGVDFCAMEVSSHGLAQYRAEALSYDLAVFTNLSRDHLDYHKTMEEYAQAKFRLFSELD
TKAQVLNADDEVGREWLAKLPDAVAVSTDASFSSEHKFVKATDVSFSLQGVKIAFESSWG
NGELNSRLIGAFNVNNLLTALAGLLVLGHDLPKLIETAPLLQGVAGRMECVVSQKNPQNR
PLVLVDYAHTPDALEKALQAARLHTEGELYCIFGCGGDRDAGKRPMMAAIAEELADKVIA
TDDNPRTEDNAKIMADILNGFVQVEKVQVIHDREQAIKTAIEQANEKDVILIAGKGHEDY
QIIGTTKHHFSDQETAAKYL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttacttccctttctcaccgaacttgatgcttgggtgacggaattaaaaccg
cttaagcaaatgacgttggattctcgccaagttgatgaaggcgatctgtttgtggcgtta
aaagggcatcaagtggatggtcgccgatttattcaaaaagcgattgagcaaggcgcagct
ttagtcttggcggaagcggacgaagggcaggacgaaattgagttggatgcgaaatttgca
aaatataacttagatcgcaccgcttgtaaggtggttttagtaccgaatttggctcgtatt
ttatcggaaattgccggtgcgttttatgccaatccgtctgaaaaacttactctcgtaggt
gtaactggtaccaacggcaagaccacaagcgcgcaattacttgcccaatggcataaccta
ttaggcggaaaatcggcggtaatggggacgatcggtaacggtttatacggcaaagtacaa
gaagcggcaaataccaccggttcggcgattgaagtgcaacgtaatttagccgactttgtg
gaaatgggcgttgatttttgtgcgatggaagtttcttcgcacggcttagctcaatatcgt
gcggaagcgttaagctatgatttagcggtattcactaatttaagccgtgatcatctcgat
taccacaagacaatggaagaatatgcacaagcaaaattccgtttgtttagcgaattagat
accaaagcacaagtattaaacgcagatgatgaagtcgggcgtgaatggttggcaaaattg
ccggatgcggttgccgtcagtaccgatgcgagctttagtagcgagcataaattcgttaaa
gcgaccgatgtgagctttagcttacaaggtgtaaaaattgcgtttgaatcgagctggggc
aacggcgagttaaatagccgtttaatcggtgcatttaacgtcaataatttactcacagca
ttagccggcttattagtgcttggtcatgatttaccaaaattaattgaaactgcaccgctt
ctgcaaggggttgccggacgtatggagtgtgtcgtttcgcaaaaaaatccgcaaaataga
ccgcttgtattagtcgattacgctcatacgccggatgcgttggaaaaagccttgcaagcg
gcacgattacataccgaaggcgagctttattgtattttcggttgcggtggtgatcgtgat
gcgggcaaacgcccgatgatggcggcgattgccgaagaactggcggataaagtgattgcg
accgatgacaatccgagaaccgaagataacgctaagattatggcggatattctcaacggt
ttcgttcaagtggagaaagtacaagtgatccacgatcgtgaacaagcaattaaaaccgca
attgaacaagcgaatgaaaaagatgtgattttaattgccggtaaagggcacgaagattac
caaattatcgggacgactaagcatcatttttcagatcaggaaaccgcggctaaatacctg
tag

DBGET integrated database retrieval system