KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0074Help
Entry
APJL_0074         CDS       T00644                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:apj03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(84310..84975)
Genome map
AA seq 221 aa AA seqDB search
MDSSLYCGYPLLIFNYPFLFMQISPLLENLMEALRALPGVGPKSAQRMAYHLLQRNRSGG
INLSKALNEAMTHIGHCRSCRTFTEEDECNICKNPRRQMSGQLCVVEMPEDIQAIEQTGQ
FSGRYFVLMGHLSPLDGIGPREIGLDLLQSRLENESFHEVILATNPTIEGDATANYIAEM
CRIHNVKVTRIAHGIPVGGSLEMVDGTTLSHSFAGRRDISL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcgctttattgcggctatccattattaattttcaactatccgtttctattt
atgcaaattagccctttactcgaaaatctgatggaagccctacgtgcattacccggcgtc
ggtccgaaatccgcacaacgtatggcgtatcatttattgcaacgcaatcgttccggcggt
atcaatttatccaaagccttaaatgaagcgatgacgcatatcggtcattgccgttcttgc
cgtacttttaccgaagaagacgaatgcaatatttgtaaaaatcctcgtcgccaaatgagc
ggtcagctttgcgtagtagaaatgccggaagatattcaagcgattgaacaaaccggacag
ttttcgggacgttatttcgtattaatgggacatctttcaccgctagacggtatcggaccg
agagaaatcggcttggatttgttacaaagccgtttagaaaacgaatcttttcacgaagtt
attctagctaccaatccgaccattgaaggtgatgccaccgccaactatattgcggaaatg
tgccgcattcacaacgtgaaagtaactcgaattgcgcatgggattccggtcggcggttca
ttagaaatggtggacggtacgaccctttcccactcttttgccggcagacgagatatttcg
ttataa

DBGET integrated database retrieval system