KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0074Help
Entry
APJL_0074         CDS       T00644                                 

Gene name
recR
Definition
(GenBank) recombination DNA repair protein
  KO
K06187  
recombination protein RecR
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APJL_0074 (recR)
DNA repair and recombination proteins [BR:apj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     APJL_0074 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      APJL_0074 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(84310..84975)
Genome map
AA seq 221 aa AA seqDB search
MDSSLYCGYPLLIFNYPFLFMQISPLLENLMEALRALPGVGPKSAQRMAYHLLQRNRSGG
INLSKALNEAMTHIGHCRSCRTFTEEDECNICKNPRRQMSGQLCVVEMPEDIQAIEQTGQ
FSGRYFVLMGHLSPLDGIGPREIGLDLLQSRLENESFHEVILATNPTIEGDATANYIAEM
CRIHNVKVTRIAHGIPVGGSLEMVDGTTLSHSFAGRRDISL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcgctttattgcggctatccattattaattttcaactatccgtttctattt
atgcaaattagccctttactcgaaaatctgatggaagccctacgtgcattacccggcgtc
ggtccgaaatccgcacaacgtatggcgtatcatttattgcaacgcaatcgttccggcggt
atcaatttatccaaagccttaaatgaagcgatgacgcatatcggtcattgccgttcttgc
cgtacttttaccgaagaagacgaatgcaatatttgtaaaaatcctcgtcgccaaatgagc
ggtcagctttgcgtagtagaaatgccggaagatattcaagcgattgaacaaaccggacag
ttttcgggacgttatttcgtattaatgggacatctttcaccgctagacggtatcggaccg
agagaaatcggcttggatttgttacaaagccgtttagaaaacgaatcttttcacgaagtt
attctagctaccaatccgaccattgaaggtgatgccaccgccaactatattgcggaaatg
tgccgcattcacaacgtgaaagtaactcgaattgcgcatgggattccggtcggcggttca
ttagaaatggtggacggtacgaccctttcccactcttttgccggcagacgagatatttcg
ttataa

DBGET integrated database retrieval system