KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0261Help
Entry
APJL_0261         CDS       T00644                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apj00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    APJL_0261 (recD)
Enzymes [BR:apj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     APJL_0261 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
279340..281259
Genome map
AA seq 639 aa AA seqDB search
MLTLLYELKETNVISELDYQFAKMIDRKQQSYPYTEQQKNLAVLLAALVSFHVMHGHAAI
RLDSQASRFFFGLSNRNEEKALNDEILQKIGGITPLEWQDVLQNHIAFSSDPKQVAPMLF
QHGLLYFYRYWQAENNIANYLVKAVEFPEQIANTALNKQILEKLFEKSDEINWQKIAVAT
AIKQKFSIISGGPGTGKTTTVAKLLAALQEKQLRSGKAMLNVALVAPTGKAAARLKESIT
LSLSVLNLNFEIPTTASTIHRLLGIRPQSDEPRYHSKNPLHIDLLVVDEASMIDLFLMEK
LMAALKPNTRLIILGDKDQLASVEAGAIMGELGAFLQQGYSRKHCDYLNQVTEYQLVPKG
KSLPICDSLCHLKKSYRFDANSGIGQLAKLVNEKQAVESWQLFAKGSADLSLIEYAHTSD
FPEKQQWIQNCVKQITDKAVELYKEYLTLVKQRYNNPTKVSVNEIFEVFQKVRFLSALRI
SELGVEQLNKRIETALATAKLISLEQSKNYYIGKPLLITQNSPQNHIYSGDIGIILPDEN
GISRVYFDTKIDDGYLSLSLNRLPEFEPAYVMTVHKSQGSEFEHTLLITPLHFAPVMSKE
LIYTAITRAKKHFTLFGEKQVWLQAVNNNLQLRLKAQLL
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcttttatatgagttaaaagaaacgaatgtgatttccgaattggattatcaa
ttcgctaaaatgattgatcgtaaacagcaaagttatccctataccgaacaacaaaaaaac
ttggcggtattgcttgccgcattagtttcttttcacgtaatgcacggtcatgccgctatt
cgtttggattctcaagcctcacggttttttttcggtttatcaaatcgaaatgaggaaaag
gcgcttaatgatgaaattttgcaaaaaatcggcggaatcacgccgcttgaatggcaggac
gtactacaaaaccatattgcgtttagttcggatcctaagcaagtcgcaccgatgttgttt
caacacgggttactttatttttatcgttattggcaggcggaaaacaatattgcgaattac
ttagtgaaagcggtcgaatttcccgaacaaattgccaataccgcattgaataagcaaatt
ctagaaaaactatttgaaaagtcggatgaaataaattggcaaaaaatagcggtcgctacg
gctatcaaacaaaagtttagcataatttcaggcgggccgggaaccggtaaaactacaacg
gtcgccaaattattagctgcgttgcaagaaaaacagctacgtagcggtaaagcaatgttg
aatgttgcgcttgttgcaccgacaggaaaagcggcggcacgtttaaaagagtcaatcaca
ttaagtttaagcgtgcttaatttgaattttgaaattccaacgaccgcctcgacaattcat
cgtttgttaggaatacgtccgcaaagtgatgagcctcgttatcactcaaaaaatccgtta
catattgatcttttagtggtggatgaagcgtctatgattgatcttttcttaatggaaaaa
ttaatggcggcattaaaaccgaatacccgattaattattttaggcgataaagatcagctt
gcgtcggttgaagccggagcgattatgggagaactcggagcgtttcttcaacagggatat
agccggaaacattgcgattatttgaatcaagttaccgagtatcaattagttccgaaagga
aaatcattacctatttgtgattcgttatgtcatttgaaaaaaagttatcgttttgacgct
aattccggaatcggtcagttggcgaaactggttaatgaaaagcaagcggttgaatcttgg
caactttttgcaaaaggctcagcggatttatctttgatcgaatatgcacacacttcggat
ttcccggaaaaacagcagtggattcaaaattgcgtgaaacaaataacagataaagcggtc
gagctttataaggaatatctaacgcttgttaaacaacgttacaataatccgacgaaagtg
tcggtaaatgaaattttcgaggtttttcaaaaagtaagattcttatccgcattgcgtata
agtgaattgggcgtagagcaattaaataaaaggatagaaacggcattagcgacggcaaaa
ctgatttctttagaacaaagtaaaaattactatatcggtaaaccgttactcattacacag
aactcgccgcaaaatcatatttatagcggcgatatagggattatcttaccggatgagaac
ggaatatcgagagtttattttgatacgaaaattgacgatggatatttaagtctttctctg
aatagacttcccgaatttgaaccggcttatgtaatgacggttcataagtcgcaaggttct
gaattcgaacataccttactgataacgccattgcactttgcaccggttatgagtaaagaa
ttaatttatacggcgattacccgagctaaaaagcattttactttattcggagaaaaacaa
gtttggttacaggcggtgaataataatcttcagctaaggttaaaagctcaattactttag

DBGET integrated database retrieval system