KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0278Help
Entry
APJL_0278         CDS       T00644                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APJL_0278
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APJL_0278
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APJL_0278
Enzymes [BR:apj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APJL_0278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
300467..301561
Genome map
AA seq 364 aa AA seqDB search
MKFICNQCQQIAPVSTRQAKCQCGGLWTLDYQPPKFDLNEIDQHEWNLFRYRKFIALQDE
SWRDISLGEGMTPIVRFDENVLLKMDYFMPTLSFKDRGAAVLISHCKSIGVDSVVQDSSG
NAGNSVAAYCAKAGIQCEIFVPEGTSPKKINMIESHGAKANVIKGSRDHCADVCRAKVEN
EGVYYANHVYNPFFYEGTKTYIYETFEQLGRIPKHIVVPVGNDTLFIGVIKGLEHLLESG
VIDEMPTIIALQSEYCDPLLQAVKKGQKFAEQVEIKPTIAEGIAIGQPMRASEILAYAEK
YAIRFVHAPEDKIIAARNALAKKGIYCEHTTAANYAAYLHYCELYGAVEDCLITMCGTGL
KSDH
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatctgtaatcaatgccaacaaattgcgccggtatctactcgccaagcaaaa
tgtcaatgcggaggcttatggacactggattatcaaccgcctaaattcgatctcaacgag
attgatcagcatgagtggaacttatttcgttatcgaaaatttattgctttgcaagatgaa
agttggcgtgatatttccttgggtgaggggatgacgccgatagtccgctttgatgaaaat
gtattattaaaaatggattattttatgccaacgctttcctttaaagaccgtggtgcggcg
gtacttatcagtcattgtaagtcgattggtgttgattcagtggtacaagatagtagtggt
aatgcaggcaatagtgtcgcagcctattgcgctaaagcgggtattcaatgtgaaattttt
gtaccggaaggaacatcgccgaaaaaaattaatatgattgagtcgcatggtgctaaagct
aatgtgattaaaggtagccgtgatcattgtgcagatgtatgtcgtgctaaagttgaaaat
gagggcgtttattatgccaatcacgtgtataaccccttcttctacgaaggtacgaaaacc
tatatttatgaaacgtttgagcagctcgggcggattccaaaacatattgtcgttccggtt
ggaaacgatactttgtttattggtgtcattaaaggactagaacatttgttggaaagtggc
gttattgatgaaatgccaacgattattgcattacaaagcgaatattgtgatccattattg
caagcggtcaaaaaagggcaaaaatttgcagaacaggttgagattaagccgactatcgcc
gaaggtattgccattggacagcctatgcgagcaagtgaaattttagcttatgcggaaaaa
tatgcgattcgttttgttcatgcaccggaagataaaattattgcggcacgaaacgctttg
gccaaaaaagggatttattgtgaacacactaccgcagccaactatgcggcttatcttcac
tactgtgagctatatggtgcagtagaagattgcttaattacgatgtgtggtaccggactc
aaatcggatcattaa

DBGET integrated database retrieval system