KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0393Help
Entry
APJL_0393         CDS       T00644                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:apj00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
428751..430262
Genome map
AA seq 503 aa AA seqDB search
MTKEYIIALDQGTTSSRAVLLDKNANIVEVSQREFTQIYPQVGWVEHNPMEIWATQSSTL
NEVVAKAGITSDKIAAIGITNQRETTIVWEKETGKPVYNAIVWQCRRTADICAKLKEDGH
EAYIRKTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQGRVHV
TDYTNASRTMMFNIHTKQWDDKMLELLNIPRSMLPEVRNSSEVYGETNIGGKGGVRIPVA
GMAGDQQAALYGHLCVEAGQAKNTYGTGCFMLMNTGNEAVESKNGLLTTIACNAKGEPCY
ALEGSIFMGGASIQWLRDELKIVHDSKDSEYFATKEDSTNGVYVVPAFTGLGAPYWDPYA
RGAILGLSRGANRNHIVRATLESIAYQTRDVLDAMQSDSGKHLATLRVDGGAVANNFLMQ
FQADILNANVERPVVREVTALGAAYLAGLAVGFWKDLQELRGKASIERTFVPDGDEAKRT
RRYKGWKKAVKRALEWAKEDAEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaatacattattgcgttagaccaaggtacgacaagctctcgtgcggtgtta
ctcgacaaaaacgccaatatcgtagaggtttctcaacgtgaatttacccaaatttatccg
caagtcggttgggtggaacataacccgatggaaatttgggcgacgcaaagttcgacatta
aatgaagtggtggcaaaagcgggcattacttccgataaaattgcggcaatcggtattacc
aaccaacgtgaaactacgattgtatgggaaaaagaaaccggtaaaccggtttataatgcg
attgtatggcaatgccgtcgtacggcggatatttgtgcgaaattaaaagaagacgggcat
gaagcttatattcgtaaaacgaccggtttagtggtggacccgtatttctccggtacgaaa
gtaaaatggattttagataatgttgaaggcgcaagagaaaaagccgagcgcggcgagctg
ttattcggtacggtagatacttggttggtttggaaattaacccaaggtcgcgtgcacgtt
accgattacacaaacgcttcccgtactatgatgttcaatattcataccaaacaatgggac
gataaaatgttggaattattaaatattccgcgttctatgttaccggaagtaagaaattca
tcggaagtttacggcgaaaccaatatcggcggtaaaggcggcgtacgtattccggtagcc
ggtatggcgggcgaccaacaagcggcgctttacggtcatttatgcgtagaagccggtcag
gcgaaaaatacttacggtaccggttgctttatgttgatgaataccggtaatgaagcggtc
gaatcgaaaaacggtttgctgactaccatcgcatgtaacgcaaaaggcgaaccgtgctat
gcgttggaaggttcgatttttatgggcggtgcttcgattcagtggttacgtgacgaactt
aaaatcgtacatgacagtaaagactccgaatattttgcaacaaaagaagacagcacaaac
ggtgtgtatgtcgtaccggcgtttaccggcttaggcgcgccgtattgggatccgtatgct
cgaggtgcgattttaggactttctcgcggtgcaaaccgtaaccatatcgtacgtgcgaca
ttagagtctatcgcatatcaaacccgtgacgtattggatgcgatgcaatcggatagcggt
aaacatcttgcgactttacgtgtggacggcggtgcggttgccaataacttcttaatgcaa
tttcaagcggatattctcaatgctaacgtagaacgtccggtcgtgcgtgaagttaccgct
ttaggtgcggcatatcttgccggtcttgctgtaggattctggaaagacttgcaagaatta
cgcggtaaagcgtcgattgagcgtacctttgttccggatggcgacgaagcaaaacgtacc
agacgttataaaggttggaaaaaagcggttaaacgtgcgttagaatgggcaaaagaagac
gcagaggaataa

DBGET integrated database retrieval system