KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0428Help
Entry
APJL_0428         CDS       T00644                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:apj00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
468896..470086
Genome map
AA seq 396 aa AA seqDB search
MKKLVILGSTGSIGKSTLSVVEQNKTEYEVFGLVGGKNVELMAAQCLLFQPKFAALDDEN
AAKALEEQLRQLNVKTEVLSGQKAICELSAHPEVDMVMAAIVGAAGLLPTLSAVKAGKKV
LLANKESLVTCGQIFIDEARKSGAQLLPVDSEHNAIFQSLPPEAQQKVGFCPLAELGVSK
IILTGSGGPFRVKPLDEFAAITPAQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWLFN
ASAEEMEIIIHPQSIIHSMVRYIDGSVIAQMGNPDMCTPIAHTMAYPKRINAGVAPLDFF
KLKELTFIEPDFARYPNLKLAIDAFAEGQYATTAMNAANEVAVEAFLNERIRFIDIVNVN
RTVVENIAPVQVKEIADVLHIDKLARELAEQAVINL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagtcattttaggttcaactggttcaatcggtaaaagtaccttatcggtg
gtggaacagaacaaaaccgaatacgaagtattcggtttggtcggcggtaaaaatgttgaa
ttgatggcggcgcaatgcttattgtttcaaccgaaatttgccgcattagatgatgagaac
gctgcaaaagcgttggaggaacagcttagacaattgaatgtaaaaaccgaagtattaagc
ggtcaaaaagcgatttgtgaattgagcgcacatccggaagtggatatggtgatggcggcg
attgttggggcggcaggtttgcttccaaccctttcagcggttaaagcgggtaaaaaagtc
ttattggcaaataaagaatcgttagttacttgcggacaaatttttattgatgaagcaaga
aaatccggtgcgcaactcttaccggtggatagtgaacataatgcgattttccaatcccta
ccgccggaagcgcaacaaaaagtcggtttttgcccgcttgccgagttaggcgtgagcaaa
attattttaaccggttctggcggtcctttccgtgtgaaaccgttagacgaatttgcagcg
attacaccggcacaagcggttgctcacccgaattggtctatgggtaagaaaatctcggtc
gatagtgccacgatgatgaataaaggcttggaatatattgaagcccgttggttattcaat
gcgtcggcagaggagatggaaattattattcatccgcaatcgattattcattcgatggta
cgttatattgacggttccgttattgctcaaatgggtaatccggatatgtgtacgccgatt
gcacatacgatggcgtatccgaagcgcattaatgccggcgtggctccgttagatttcttt
aaattgaaagaattaacctttatcgaaccggactttgctcgctatccgaatttaaaatta
gcaattgatgcgtttgcggaaggtcagtatgcgacaactgcaatgaatgcggcaaatgaa
gtggcggttgaggctttcttaaacgagcgtattcgttttattgatattgtgaacgtgaat
agaacagtggtggaaaatattgcaccggttcaagtgaaagaaatcgccgatgtgttacat
atagataaattggcacgagaattggcggaacaagcggtcattaatttatag

DBGET integrated database retrieval system