KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0481Help
Entry
APJL_0481         CDS       T00644                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00020  Citrate cycle (TCA cycle)
apj00310  Lysine degradation
apj01100  Metabolic pathways
apj01110  Biosynthesis of secondary metabolites
apj01120  Microbial metabolism in diverse environments
apj01130  Biosynthesis of antibiotics
apj01200  Carbon metabolism
Module
apj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APJL_0481 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    APJL_0481 (sucB)
Enzymes [BR:apj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     APJL_0481 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Hep_59
Motif
Other DBs
NCBI-ProteinID: ABY69062
UniProt: B0BTV7
Position
complement(529488..530717)
Genome map
AA seq 409 aa AA seqDB search
MTIEILTPVLPESVADATVATWHKKVGDTVKRDEVLVEIETDKVVLEVPAPNDGVLAEIS
QEQGATVTSKQLLGKISTVQAGDFTQETIKQANEATPADRKSAAIEYDHSDADSQGPAIR
RLLAEHNIEAHLVKGTGVGGRITREDIEHYLAQRQVQETKQAMASEHNTVSTVAYSARSE
KRVPMTRLRKRIAERLLEAKNTTAMLTTFNEVDMQPIMSLRKTYGEKFEKQHGVRLGFMS
FYIKAVVEALKRYPEINASIDGDDVVYHNYFDISIAVSTPRGLVTPVIRNCDKLSMADIE
KTIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPV
AVNGQVVIRPMMYLALSYDHRLIDGRESVGFLVAVKDLLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgactattgaaattttaactcccgtgctacccgaatccgtcgcggatgctaccgttgcg
acttggcacaaaaaagtaggcgatacggttaaacgtgacgaagtacttgttgaaattgaa
acggataaagtcgttttagaagtgccggcaccgaatgacggcgtattagcggaaatcagc
caagagcaaggcgcaaccgttacttctaaacagttacttgggaaaatctcaaccgttcaa
gcgggagattttacgcaggaaactatcaaacaagctaacgaagcgactcccgccgatcgt
aaatccgccgccatcgaatatgatcactcggatgccgactctcaaggtccggcaattcgt
cgtttattagcggaacataatatcgaagcgcatttagtcaaaggtaccggtgtcggcggt
cgtattacccgtgaagatatcgaacactatcttgcacaacgtcaggttcaagaaaccaaa
caagcgatggcaagcgaacacaatacggtaagtaccgtagcttactccgctcgtagcgaa
aaacgcgtgccgatgacacgtttacgtaaacgtattgccgaacgtctgttagaagcgaaa
aacactactgcaatgctgaccaccttcaacgaagtggatatgcagccgattatgagctta
cgtaaaacttacggtgagaaatttgaaaaacaacacggcgtgcgtttaggctttatgtcg
ttctatattaaagcggtggtagaagcgttaaaacgttatccggaaatcaatgcttcgatt
gacggcgatgatgtggtatatcacaactacttcgatattagtattgcggtatccactccg
cgcggattagtcacgccggtgattcgtaactgcgataaattatcgatggcggatattgag
aaaaccattaaagcacttgccgaaaaaggacgtgacggtaaactaaccgtagaagaccta
accggcggtaactttaccattactaacggcggcgtattcggttcgttaatgtccactccg
attatcaatccgccgcaaagtgcgattttaggtatgcatgcgattaaagatcgccctgtc
gcagtaaacggtcaagtggtgattcgtccaatgatgtatcttgccttgtcttatgaccac
cgcttaattgatggacgtgaatctgttggtttcttagttgcggtcaaagatttattagaa
gacccgacccgtttactacttgaaatctaa

DBGET integrated database retrieval system