KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0485Help
Entry
APJL_0485         CDS       T00644                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Brite
Enzymes [BR:apj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     APJL_0485 (dsbC)
Secretion system [BR:apj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   APJL_0485 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
536403..537098
Genome map
AA seq 231 aa AA seqDB search
MKKNVTALFSVSLMGLCVSPVMADDMSLVKTLEGMGATNVKISDSALPGFRTAISNEGVV
QISENGRFVIQGQIFELKNGKAVNITNKSLLADLNALEKEMIIYPAKNEKHVVTVFMDIT
CHYCHLMFQRIKEYNDLGITIRFLAFPRGGMNTQTAKQMEAIWTSADKVKALTDAENGTL
PKEVKTPNIVKKHYELGIKFGVTGTPNMVDSTGQLIAGYVEPKELLKMLSE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatgtaacggcattattttccgtttctttaatgggcttatgcgtatctccc
gtgatggctgatgatatgagcttggtaaaaacgttagaagggatgggggcaacgaatgta
aaaatcagtgattcggcgctgcccggttttagaaccgccatttcaaatgaaggcgtggta
caaatcagtgaaaacggacgttttgtgatccaagggcaaatttttgaactgaaaaacggc
aaagcggttaatattactaacaaatcattgttagcggatttaaatgcattggaaaaagag
atgattatttatccggcaaaaaatgagaagcacgtagttaccgtatttatggatattacc
tgtcattattgccatttaatgttccaacgtattaaagagtataacgatttgggtattacc
attcgtttcctcgctttccctcgcggcggaatgaatacacaaaccgcaaaacaaatggaa
gcgatttggacatcggcggataaagtgaaagcattaaccgatgcggaaaacggtacttta
ccgaaagaagtaaaaacaccgaatatcgtgaaaaaacactatgaactcggcattaaattc
ggcgtaacaggtaccccgaatatggtcgatagcaccggtcaattgatagccggttatgta
gaacctaaagaattacttaaaatgttaagcgaatag

DBGET integrated database retrieval system