KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0496Help
Entry
APJL_0496         CDS       T00644                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00260  Glycine, serine and threonine metabolism
apj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
apj01100  Metabolic pathways
apj01110  Biosynthesis of secondary metabolites
apj01130  Biosynthesis of antibiotics
apj01230  Biosynthesis of amino acids
Module
apj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APJL_0496 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APJL_0496 (trpB)
Enzymes [BR:apj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     APJL_0496 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABY69077
UniProt: B0BU72
Position
547388..548578
Genome map
AA seq 396 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEETFVAAQNDPLFQAEFTDLLKNYAGRPTAL
TLCRNLTKGSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDLPCVIYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWAA
NYETTHYLIGTAAGPHPFPTMVREFQKMIGEETKRQILEKENRLPDAVIAAVGGGSNAIG
MFAGFIEEKSVQLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQTKDGQIEESYS
ISAGLDFPSVGPQHAYLNSIGRAEYVSITNQEALDAFQALAQHEGIIPALESSHALAYAL
KLIAQNPDKEQLLVVNLSGRGDKDIFTVDKILNGGN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaatccttatttcggcgaatttggcggaatgtatgttccggaa
attctcgtaccggtcttaaaacaactcgaagagacatttgttgctgcgcaaaatgatccg
cttttccaagcggaatttaccgacttactgaaaaactacgccggtcgtccgaccgcatta
acgctttgccgtaatctcaccaaaggaagtaaaaccaagctttatcttaaacgtgaagat
ctgttacatggcggcgcacataaaactaaccaagtattagggcaagccctgttagcaaag
cgtatgggcaaaactcgcattattgcggaaaccggtgccggacaacacggggtggcaacc
gcattggcgtgtgcaatgttagatttaccttgtgtgatctatatgggtgctaaagatgtg
gaacgccaatcaccgaatgtattccgtatgcgtttgatgggtgcagaagtgattccggta
caaaaaggctcttgttcattaaaagatgcctgctgtgaagcaatgcgtgactgggcggca
aactatgaaacgacacattatttaatcggtacggcggcaggcccgcacccgttcccgacc
atggtgcgtgaatttcagaaaatgatcggcgaagaaaccaaacgacaaatattagaaaaa
gagaaccgcttaccggatgcggtgattgctgcggttggcggtggctcgaatgccatcggt
atgtttgcaggttttattgaggaaaaaagcgtgcagctaatcggtgtagaaccggctggc
aaaggcattgaaaccggcgaacacggcgcaccgcttaaacatggtaccaccggcatttat
ttcggaatgaaatcgccaattatgcaaactaaggacggacaaatcgaggaatcttattcg
atctcggcaggtttagatttcccgtcagtcgggccgcaacatgcttacctcaattcaatt
ggacgagcagagtatgtctcaattaccaaccaagaagcgttagatgctttccaagcatta
gcacaacatgaaggtattattccggcattagaaagttcacatgcattggcttatgcgctg
aaattaattgcacaaaatccggataaagaacaactattggttgtgaatctctccggtcgt
ggcgataaagatatttttaccgtagataaaattttaaatgggggaaactaa

DBGET integrated database retrieval system