KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0654Help
Entry
APJL_0654         CDS       T00644                                 

Definition
type III restriction-modification system restriction subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Brite
Enzymes [BR:apj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     APJL_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(711644..714661)
Genome map
AA seq 1005 aa AA seqDB search
MKLQFKTQQYQTNAVNAVVGVFDGQPYRGLREYRMDMGNAKQVRMGFYDGFRNAEIIDTV
KQNLLANIQNVQANQNLPLSEKLATQTNTLNLDIEMETGTGKTYCYIKTIFELNRQYGWS
KFVIIVPSVAIREGVKKSFEITADHFQQEYGKKARSFIYNSSQLHEIESFSSNTDINVMI
INIQAFNASGKDNRRIYEELDDFGSRKPIDVLSANRPILILDEPQKMEGKKTLEALAKFN
PLMILRYSATHKTEHNKIHRLDALDAYNQKLVKKIAVRGITIHGLTGTKAYIYLQQIHIS
SNKAPTATVELEFKLASGEISRKICKIEKGDRLAEKTGLSQYDGFVVSEIEANGFTVEFT
NGVKINQGEAYGDVTEEQMRRIQIRETILAHFEKERVLFSQGIKVLSLFFIDEVAKYRDY
SREDTKGEYARIFEEEYHKVLADTLMEFNFNPDYLDYLRGISAEKTHYGYFSVDKKSKKW
VDPSIKTRGEEAGQSDDVDAYDLILKDKERLLSFGEKTRFIFSHSALREGWDNPNVFVLC
MLKHSDNTISRRQEVGRGLRLAVNKLGERQDNPANVHEINVLTVIANESYSTFVDNLQKE
INSKLSRKVKLDKDFFSSKVLKTENGNITINEEIAEAIQYWLIRMGYVDSKYQPTAEFQK
AISERTLENLPSELENYQQAFVALLQGSTGSASDYAIENGRKQSNPRNANFDRKEFKALW
DKINRKAVYQVDFDSDELIKNCVEALNRHLNVTELTYTVREGVQKSQISDRDLDEKTAFK
VEETSNNRYNANLQIATRYDLVGQVTSQVKLTRQTVATILTKIEPAIFAKFAKNPEQFIS
EAVRLINEQKAYTIVEKLSYNLLEERFDSSIFIPEQSFNDLSNVVTNVKKHIYDYVKVDS
DVERKFVEELDTDKKVVVYTKLPSGFFIPTPVGNYNPDWAISFEEGSVKHIYFIAETKGS
LSSLNLKGAESSKIECARKFFAELSNAELKYGVVTDYRKLVELVN
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaatttaaaacgcaacagtaccaaaccaatgccgttaatgcggtggtgggc
gtatttgatggtcagccttatcgtgggctgcgtgaataccgtatggatatgggcaatgcc
aaacaagttcgtatgggattttatgatggtttccgcaatgcggaaatcatcgacacagta
aaacaaaatttgcttgccaacattcaaaacgtgcaagcaaaccaaaatttacctttgtcg
gaaaaattggcaacacaaaccaataccctcaatttagacatcgaaatggaaaccgggacg
gggaaaacttactgctatatcaaaacgatttttgaattaaatcgccaatatggttggagt
aagtttgtgattatcgtgccgagtgtggccattcgtgagggggtaaaaaaatcctttgaa
atcaccgcagatcatttccaacaggaatatggcaaaaaggctcgttcgtttatttacaac
tcaagccagttgcacgagattgagagtttttcgtctaataccgacatcaatgtgatgatt
atcaacattcaggcgtttaatgcgtctgggaaagataaccgccgtatttatgaagagtta
gacgattttggatctcgtaaacccatagacgtgttaagtgccaaccgccctattttgatt
ttggacgaaccgcagaaaatggagggtaagaaaacccttgaagccttggcgaaatttaat
ccattgatgattttgcgttattcggcaacccataaaacggagcataataaaattcatcgc
cttgatgcgttagatgcctacaaccaaaaattagtgaaaaaaattgcggtgcgaggcatt
actattcacggtttaacgggcacgaaggcttatatttatttgcaacaaattcatatttct
tccaacaaagcaccaacggcgacagtggagttggaatttaagttagcaagcggtgagatt
tctcgaaaaatttgcaaaattgaaaaaggtgatcgcttagcggagaaaacaggcttgtcg
cagtacgatggctttgtggtaagtgagattgaggcaaatggctttacagtggaatttacc
aatggcgtgaagattaaccaaggagaagcctatggcgatgttaccgaagagcaaatgcgg
agaatccaaattcgagagacgattcttgcccattttgagaaagaacgtgtgctgtttagt
caaggcattaaggtgctttcgttattcttcattgatgaagtagcgaaatatcgtgattac
agccgagaagataccaaaggtgaatatgctcgcatttttgaagaagagtatcacaaagtg
ttggcagatacgctgatggagtttaattttaaccctgattatttggattatttgcgaggt
atttctgcggagaaaacccattacggctatttttcggtggataaaaaatcgaaaaaatgg
gttgatccaagtattaaaactcgaggggaagaagcggggcaatcagacgatgtggacgct
tacgatttgattttaaaagacaaagaaagattactttcttttggtgagaaaactcggttt
attttctcgcactctgcattgcgtgaaggttgggataacccgaatgtgtttgtgctttgt
atgctaaaacatagcgataatactatttctcgccgtcaagaagtggggcgtggtttacgt
ttagccgtaaataaattgggcgaacgccaagataacccagctaatgttcacgaaattaac
gtgctaaccgtaattgctaacgaaagctacagcacttttgtggataatttgcaaaaagaa
attaatagcaagctttctcgtaaagtgaaattggataaagatttctttagtagcaaggta
ttaaagacggagaatggtaatatcactataaatgaggaaattgcggaagcaatacagtac
tggcttatcagaatgggttacgtggatagtaaataccaacctacggcagaatttcaaaaa
gcgatctctgaaaggacattggaaaatttaccgtctgagttggaaaattaccaacaagca
tttgtggcgttgttgcaaggttcaacaggatcggcaagtgattatgctattgagaatggg
cgtaaacaatctaatccacgtaatgctaattttgatcgtaaggaatttaaagccttgtgg
gataaaattaaccgtaaagcggtgtatcaggtggattttgattctgatgagctgatcaaa
aattgtgtggaagcattgaatcgccatttgaatgtgacggaattaacttataccgtgcga
gaaggggtacagaaatcacagatttcagaccgagatttagatgaaaaaacagcatttaaa
gtagaagaaacctcaaataatcgctataacgctaatttacagattgcgactaggtatgat
ttggttgggcaagtaacaagccaagtaaaactgactcgtcaaacggtagcaacgatttta
acgaaaattgaacctgctatttttgctaaatttgcgaaaaatccagagcaatttattagc
gaagcggtgcggttaatcaacgagcagaaagcctatacgattgtggaaaaattaagctac
aacttgctagaagagcgttttgatagcagtatttttataccagagcagtcgttcaatgat
ttatctaatgtggtcactaatgtgaaaaaacatatttacgattatgtcaaagtggattct
gatgtagaacgtaaatttgtggaagaattggataccgacaaaaaagtggtggtttatacc
aaattaccgtctggcttttttattccaacccctgttggaaactataatccagactgggca
atttcttttgaagaaggctcggtaaaacatatctatttcatcgcagaaaccaaaggttct
ctctcttctctgaatttaaaaggggcagaatcaagcaaaatcgagtgtgcgagaaaattc
tttgctgaattaagcaatgccgagttgaaatacggtgtggttacggactatcggaagcta
gtcgagttagtgaattaa

DBGET integrated database retrieval system