KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0775Help
Entry
APJL_0775         CDS       T00644                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide s-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00010  Glycolysis / Gluconeogenesis
apj00020  Citrate cycle (TCA cycle)
apj00620  Pyruvate metabolism
apj01100  Metabolic pathways
apj01110  Biosynthesis of secondary metabolites
apj01120  Microbial metabolism in diverse environments
apj01130  Biosynthesis of antibiotics
apj01200  Carbon metabolism
Module
apj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APJL_0775 (aceF)
   00020 Citrate cycle (TCA cycle)
    APJL_0775 (aceF)
   00620 Pyruvate metabolism
    APJL_0775 (aceF)
Enzymes [BR:apj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APJL_0775 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N Biotin_lipoyl_2 GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABY69338
UniProt: B0BP53
Position
complement(848978..850876)
Genome map
AA seq 632 aa AA seqDB search
MSKQINVPDIGSDEVSVTEVMVKAGDTITVDQSIINVEGDKASMEVPAPEAGVVKEVLVK
VGDKVTTGSPMLVLEAAESAPAPVAEAPVQAVAPVATASAVVEVNVPDIGSDEVNVTEIM
VKVGDSVEVDQSIINVEGDKASMEVPAPIAGVVKEILINVGDKVTTGKLIMKFETVSAAP
AAEEAPAQAAAPVATASAIKEVNVPDIGGDEVNVTEIMVNVGDTVSEEQSLITVEGDKAS
MEVPAPFAGVVKEILVKSGDKVSTGSLIMKFEVAGAAPAAAPAPAAQAAAPAPAAQPAAQ
PAQSGNVSGLSQDVVAAAGAYAHATPVIRRLAREFGVNLDKVKGSGRKGRIVKEDIQAYV
KTAVQVFEKQGGTAAAATGAANGAGLGLLPWPKVDFSKFGEVEEVELSRINKISGANLHR
NWVMIPHVTHFDRTDITDLEAFRKEQNKLAEKQKLDVKITPVVFIMKAVAKALEAFPRFN
SSISEDAQRLTLKKYINIGVAVDTPNGLVVPVFKNVNKKGIVELSRELMEVSKKARDGKL
TASDMQGGCFTISSIGGLGTTHFTPIVNAPEVAILGVSKSEMAPVWNGKEFEPRLMLPLA
LSFDHRVIDGADGARFLTYINGVLADIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattaatgtgccagacatcggttcggatgaagttagcgtaaccgaagtc
atggtaaaagcaggcgatacaattactgttgatcaatcgattattaatgtagaaggcgac
aaagcttcaatggaagttccggcgccggaagcaggtgttgttaaagaagttttagtaaaa
gtcggcgataaagttacaaccggttcaccaatgctagtattagaagcggcagaatctgcg
ccggctccggtagcggaagcgcctgtacaagccgtagcgcctgtggcaacagcatcagcg
gttgttgaagtgaacgtaccggatatcggttcggacgaagtaaacgtaaccgaaattatg
gttaaagttggtgattcggttgaagttgatcaatcaatcattaatgtagaaggtgataaa
gcttcaatggaagttccggcacctatcgcaggcgttgtaaaagaaattttaatcaatgta
ggcgataaagtaacaaccggcaaattaattatgaaatttgaaacggtttcagcagcgcca
gctgcagaggaagctccggcacaagccgccgcaccggttgcaacagcttcagcaatcaaa
gaagtaaatgtaccggatatcggcggtgacgaagtaaacgtaaccgaaatcatggtaaac
gttggcgatacggtatcagaagagcaatctttaattaccgttgaaggcgacaaagcttca
atggaagttccggctccgtttgcaggtgtggtaaaagaaattttagtaaaatcgggcgat
aaagtttcaaccggttcattaattatgaaatttgaagtagcaggtgcggcaccggcagca
gctcctgctcctgcagcacaagcagctgcgccagcaccagcggcacaaccggcagcgcaa
ccagctcaaagcggtaacgtttcaggtctaagtcaagacgtggtggcagcggcaggtgct
tatgcacacgcaacaccggtaattcgtcgcttagcgcgtgaattcggcgtgaacttagat
aaagtgaaaggctctggtcgtaaaggtcgtatcgttaaagaagatatccaagcatacgtt
aaaacggcagttcaagtatttgaaaaacaaggcggaacggcagcggctgcaacaggtgcg
gcgaatggcgcaggtttaggtttattaccatggccgaaagtggacttcagcaaattcggt
gaagttgaagaagtagaattaagccgtatcaataagatttcaggtgcgaacttacaccgt
aactgggtaatgattcctcacgttacacacttcgatcgtacggatatcacagatttagaa
gcattccgtaaagaacaaaataaacttgcggaaaaacaaaaattagatgtgaagatcaca
ccggttgtattcattatgaaagcggttgcgaaagcgttagaagcgttcccacgtttcaac
agttcaatctctgaagatgcacaacgtttaaccttgaaaaaatacatcaatatcggcgtg
gcggtagatactccgaacggcttagttgttcctgtatttaaaaatgtgaacaaaaaaggt
attgtcgagctttctcgcgagttaatggaagtatcgaagaaagcgcgtgacggtaaatta
accgcatcggatatgcaaggcggatgtttcacgatttcaagtatcggcggtttaggtaca
acacacttcactccaatcgtgaatgcaccggaagttgcaattttaggcgtatctaagtct
gaaatggcaccggtatggaacggtaaagaattcgaaccgcgcttaatgcttccgttagcg
ttatcattcgaccaccgtgtaatcgacggtgctgacggtgcaagattcttaacctacatc
aatggtgtattagcggacatccgtcgcttagttatgtaa

DBGET integrated database retrieval system