KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0779Help
Entry
APJL_0779         CDS       T00644                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    APJL_0779 (ipk)
Enzymes [BR:apj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     APJL_0779 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(855988..856845)
Genome map
AA seq 285 aa AA seqDB search
MTKKIILPSPAKLNLFLYITNKRADGYHELQTLFQFLDFGDDISLEVNESGEIELLNAIE
GVAKEQNLIYRAAKLLQNHTACSKGAKIGVTKRLPMGGGVGGGSSNAATVLVGLNHFWQT
GLSLEQLAELGLSLGADVPIFVRGFAAFAEGVGEKLVACQPRESWYVVLKPNVSISTAAV
FQDPNLPRNTPKRTLSRLLSEEWTNDCEKVVRDHYFEVEDLIAELLQYATFRLTGTGACI
FAEFESEAEAKAVFAHKPHNIFGFIAKGQNRSPLHQMLNLTTFPQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaaataattttacccagtccggccaagttaaatctgtttctttatatcact
aataaacgtgcggacggttatcacgaattacagacgctgtttcagttcttagatttcggc
gatgatatttcccttgaagtgaatgaaagcggtgaaatcgagttattaaacgcaatagaa
ggggtcgcgaaggaacaaaacctgatttatcgtgcggcaaaattattgcaaaatcatacc
gcttgtagcaaaggggcgaaaatcggtgtgacgaaacgtttgccgatgggcggcggtgtc
ggcggcggttcatcgaatgcggcgaccgtattggtcggattaaatcatttctggcaaacc
ggtttaagtttggaacagcttgcggaattaggactaagtttgggggcggacgtacctatt
tttgtacgaggttttgccgcttttgccgaaggtgtcggcgaaaaattagtggcttgccaa
ccgcgagagtcgtggtatgtggtattaaaaccgaacgtttccatttcgaccgctgcggtt
tttcaagatccgaatttgccgagaaatacgccgaaaagaacattaagccgacttttatcg
gaagaatggacaaacgattgcgaaaaagttgtgcgagatcattatttcgaggttgaagat
cttattgcagaattgttacaatatgcaacgtttcggctgacaggcacaggagcctgtatt
ttcgccgaatttgagagtgaagcggaagcaaaagccgtttttgcacataaaccgcacaat
attttcggttttattgcaaaaggacaaaatcgctctcctttacatcaaatgctcaattta
accactttcccacaatag

DBGET integrated database retrieval system