KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0870Help
Entry
APJL_0870         CDS       T00644                                 

Gene name
trpCF
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apj01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:apj00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(965465..966874)
Genome map
AA seq 469 aa AA seqDB search
MQNQPTILQKIVQDKAVWVDNKQKTFPLSQFQQQIVTADRDFYAALAAASHQVPAYILEC
KKASPSKGLIRAEFDLDAIAQVYKHYASVISVLTDEQYFQGDFRYIEQVKRQTMQPILCK
DFMISPYQVYLARYSNADAILLMLSVLDDETYRTLADLAHSLGMGVLTETSTEQEFERAL
ALGAKVIGVNNRDLHTLTVDMNRIVRLVEKYQEQIPADVRLISESGIYDHTQVKAIKPFA
HAFLIGSSLMGSADLNNAVRSVIFGENKVCGLTRPQDVKAVYENGFLYGGLIFAENSPRQ
LSLRQAQELVVNAPLRYVGVFQNQAVEFVEKIAKQLELYAVQLHGTEDEAYITKLSEKLA
GKTQIWQAISVDVQAETVEYHDNPLVARYILDSKHGAQQGGTGRVFDWQIISSELKPKAL
LAGGISAENIEQALVQGCLGVDLNSGVEQHKGVKDLAKMTACAEKILKA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaccaacctactattctgcaaaaaatcgtacaagataaggccgtttgggtcgat
aacaaacaaaaaacctttccactttcgcaattccaacagcaaattgttaccgctgatcgg
gatttttatgccgcactggctgcggcttcacatcaagtaccggcttatattttggaatgt
aaaaaagcctcgccatccaaaggcttgattcgtgccgaatttgatttagatgcgattgcg
caggtctataaacattacgcttccgtgatttccgtactgaccgacgaacaatatttccaa
ggcgattttcgttatatcgagcaagttaaacgccaaacaatgcaaccaatcttatgcaaa
gattttatgatttctccgtatcaggtgtatttggctcgttattcaaatgcggatgcgatc
ttgttaatgctctcggtattagatgacgaaacgtatcgcacattggcggatttagctcac
tcattaggtatgggcgttttaaccgaaaccagtaccgagcaagaatttgagcgagcgtta
gcattaggtgcaaaagtgattggcgtgaataaccgtgatttacatacgctgacggtggat
atgaatcgcattgtacgtttggtagaaaaatatcaggagcaaattccggcagatgtccgt
ttgatttcagaatcaggcatttatgatcatacgcaagtgaaagcgattaagccgtttgcg
cacgcatttttaatcggcagcagcttaatgggcagtgccgatttaaataatgcggtacgt
tcggtgatcttcggtgaaaataaagtgtgcggattaactcgcccacaagatgtcaaggca
gtgtatgaaaacggctttttatacgggggattaatttttgccgaaaattcgcctcgccaa
ttatcactacgccaagcacaagaattagtcgtgaatgcaccattgcgttatgtcggtgtg
ttccaaaatcaagcggttgaatttgtcgaaaaaatagcaaaacagcttgagttatatgcg
gtgcagttgcacggtacggaagatgaagcctatattaccaaattgtctgaaaaattagcc
ggaaaaacgcaaatctggcaggcaatttcggtggatgttcaggcggaaacggttgagtat
cacgataatccgttagtggctcgttatattctggatagcaaacacggtgcgcaacagggc
ggtacgggtagggtgtttgactggcagatcatttcaagcgaattaaaaccaaaagcactg
cttgccggtgggatttcggctgaaaatatcgaacaggctctagtacagggctgtttaggc
gttgatcttaattccggtgtagagcagcataaaggcgtaaaagatttagcaaaaatgacc
gcttgtgcggagaaaattctcaaagcctaa

DBGET integrated database retrieval system