KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0896Help
Entry
APJL_0896         CDS       T00644                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APJL_0896 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APJL_0896 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    APJL_0896 (proB)
Enzymes [BR:apj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APJL_0896 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988953..990044
Genome map
AA seq 363 aa AA seqDB search
MQKTIVIKFGTSTLTHSGKSLSRPYMLELVKQIAQLHQHHRVIVVTSGAAAAGRDYLGHP
ELPKTLAYKQMLAAVGQSQLIRTWENLFDIYGIHIGQILLTRADIDDRERFLNARDTLNA
LLEQRIIPVINENDTVATEEFKVGDNDNLSALVAILAHADQLYLLTDQEGLFDSDPRSNP
QAKLLSVVEKITPEIRQMAGGSVTGLGTGGMSTKITAADIATRSGVETVIASGSRANVLV
DLANGESIGSKFLVQSDRLEGRKQWLFAAPQVGSLVVDKGAEAALLQHKSLLPVGVSEIN
GAFSRGEVVKIFNQEGKALALGLARYNSDALIRIKGKKSKEIESLLGYEFGSVAVHIDEM
VIY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacaattgtgattaaattcggcaccagtactcttacgcacagcggaaagagt
ttaagccgtccttatatgctggaattagttaaacaaatagctcaacttcatcaacatcat
cgagtgattgtcgttacctccggagccgcggcagccggcagagattatttaggtcatccc
gaacttcccaaaacactcgcctataaacaaatgcttgccgcagtcgggcaaagtcagcta
atccgtacttgggaaaatttattcgatatttacggcattcatatcgggcaaattttatta
acccgtgccgatattgatgatcgcgaacgttttttaaatgcgcgcgataccttaaatgcc
ttgttggagcaaagaatcattcctgtgatcaatgaaaacgatacggttgccaccgaagaa
tttaaagtcggcgataatgacaatctttccgcattggttgcgattctagcgcatgccgat
caactttatcttttaaccgaccaagaaggcttatttgattccgatccgcgttcaaatccg
caagcgaaattactgtccgtcgtggaaaaaatcacgcctgaaatccgccaaatggcgggc
ggtagcgtcaccggactcggcaccggcggtatgagtactaaaattaccgccgccgatatt
gctacgcgttccggtgtcgaaaccgttatcgcttcaggctctcgtgcaaacgtattggtc
gatttagctaacggcgaatccatcggtagtaagtttttagtacaatccgaccgcttggaa
ggtcgtaaacaatggttattcgccgctccgcaagtcggctcgcttgtggtggataaaggg
gcggaagctgcattattacaacataaatcattactgccggtcggtgtttccgagattaac
ggcgcctttagccgaggcgaagtagtgaaaatttttaaccaagaaggtaaagcgcttgct
ttggggcttgctcgttataacagcgatgcgttaattcgtattaaaggaaaaaaatcgaaa
gagattgaatcgctgctcggttatgaattcggttccgtcgccgtacatattgatgagatg
gtcatttattaa

DBGET integrated database retrieval system