KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0896Help
Entry
APJL_0896         CDS       T00644                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APJL_0896 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    APJL_0896 (proB)
Enzymes [BR:apj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     APJL_0896 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988953..990044
Genome map
AA seq 363 aa AA seqDB search
MQKTIVIKFGTSTLTHSGKSLSRPYMLELVKQIAQLHQHHRVIVVTSGAAAAGRDYLGHP
ELPKTLAYKQMLAAVGQSQLIRTWENLFDIYGIHIGQILLTRADIDDRERFLNARDTLNA
LLEQRIIPVINENDTVATEEFKVGDNDNLSALVAILAHADQLYLLTDQEGLFDSDPRSNP
QAKLLSVVEKITPEIRQMAGGSVTGLGTGGMSTKITAADIATRSGVETVIASGSRANVLV
DLANGESIGSKFLVQSDRLEGRKQWLFAAPQVGSLVVDKGAEAALLQHKSLLPVGVSEIN
GAFSRGEVVKIFNQEGKALALGLARYNSDALIRIKGKKSKEIESLLGYEFGSVAVHIDEM
VIY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagacaattgtgattaaattcggcaccagtactcttacgcacagcggaaagagt
ttaagccgtccttatatgctggaattagttaaacaaatagctcaacttcatcaacatcat
cgagtgattgtcgttacctccggagccgcggcagccggcagagattatttaggtcatccc
gaacttcccaaaacactcgcctataaacaaatgcttgccgcagtcgggcaaagtcagcta
atccgtacttgggaaaatttattcgatatttacggcattcatatcgggcaaattttatta
acccgtgccgatattgatgatcgcgaacgttttttaaatgcgcgcgataccttaaatgcc
ttgttggagcaaagaatcattcctgtgatcaatgaaaacgatacggttgccaccgaagaa
tttaaagtcggcgataatgacaatctttccgcattggttgcgattctagcgcatgccgat
caactttatcttttaaccgaccaagaaggcttatttgattccgatccgcgttcaaatccg
caagcgaaattactgtccgtcgtggaaaaaatcacgcctgaaatccgccaaatggcgggc
ggtagcgtcaccggactcggcaccggcggtatgagtactaaaattaccgccgccgatatt
gctacgcgttccggtgtcgaaaccgttatcgcttcaggctctcgtgcaaacgtattggtc
gatttagctaacggcgaatccatcggtagtaagtttttagtacaatccgaccgcttggaa
ggtcgtaaacaatggttattcgccgctccgcaagtcggctcgcttgtggtggataaaggg
gcggaagctgcattattacaacataaatcattactgccggtcggtgtttccgagattaac
ggcgcctttagccgaggcgaagtagtgaaaatttttaaccaagaaggtaaagcgcttgct
ttggggcttgctcgttataacagcgatgcgttaattcgtattaaaggaaaaaaatcgaaa
gagattgaatcgctgctcggttatgaattcggttccgtcgccgtacatattgatgagatg
gtcatttattaa

DBGET integrated database retrieval system