KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0900Help
Entry
APJL_0900         CDS       T00644                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00071  Fatty acid degradation
apj00280  Valine, leucine and isoleucine degradation
apj00281  Geraniol degradation
apj00310  Lysine degradation
apj00362  Benzoate degradation
apj00380  Tryptophan metabolism
apj00640  Propanoate metabolism
apj00650  Butanoate metabolism
apj00903  Limonene and pinene degradation
apj00930  Caprolactam degradation
apj01040  Biosynthesis of unsaturated fatty acids
apj01100  Metabolic pathways
apj01110  Biosynthesis of secondary metabolites
apj01120  Microbial metabolism in diverse environments
apj01130  Biosynthesis of antibiotics
apj01200  Carbon metabolism
apj01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APJL_0900 (fadJ)
   00650 Butanoate metabolism
    APJL_0900 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    APJL_0900 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    APJL_0900 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APJL_0900 (fadJ)
   00310 Lysine degradation
    APJL_0900 (fadJ)
   00380 Tryptophan metabolism
    APJL_0900 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APJL_0900 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APJL_0900 (fadJ)
   00281 Geraniol degradation
    APJL_0900 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    APJL_0900 (fadJ)
   00930 Caprolactam degradation
    APJL_0900 (fadJ)
Enzymes [BR:apj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     APJL_0900 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APJL_0900 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     APJL_0900 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABY69458
UniProt: B0BPH3
Position
992991..995108
Genome map
AA seq 705 aa AA seqDB search
MTEQPIQQPMFQVEVDENQIAIIRIHSIDNDENWLPENFAGELREVIGTLIYRQVQGAIF
ISTRANHFIQGLKPSLFKNKTNEQLLAFSQDAQAIMRELNTLKMPIVAAIDGNCFSVGLE
LSLACDYRIASDESHTFFAMPQVRSGLLPFAGGTQRLPRLIGLRSALPLMLFGEKITAET
AKGLGLVDRLVPKTRLLTDAYQLLLEKKIQKANHKKPLTFFKKWRKQIEGNSFLREKLLD
RTENAIWLKTFGNYLAVAKLMELLKEPHFKQGLMLEQQAFVELFNSATSQVLIELKKTER
AMKDKYRIRGNVRDVAQVSILGSGYMGAGIAYLTANNAKVPVRIKDIHPSEIRKALRTCF
ELMQKATDKNQLNHGEMIQRMNLITGGERLVAAKSTDFVIEAVYEDLKLKQRMLAESESY
YSEQTIFATNTSTFAIKDIAACAIRPENVIGLHYFSPVTTQKMVEIIPHSATGEHTIATA
IHFAIQQGKIPLLVADKQGFFINRVLTPLLLEAVQCLIDGESIEFIDRSLQEFGFKLGPL
AMIDEMGLDVLVKSNSALVSELGSRFSLPQAVDLLFRNERKGCKNKRGFYMYDRFGERLQ
EDKSIYHVMETIARNDLESEQIVRRCLLRMLNEAAWCLQDKIIASTDEGNVASVLAMGFP
EFRGGIYAYIEKIGAKEIVRQLRLHTKQYGKRFEPCEWLIRQAEQ
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaacccattcagcaaccgatgtttcaagtcgaagtagatgaaaatcagatt
gccatcattcgcattcactctattgataatgatgaaaactggcttcccgaaaattttgcc
ggcgaattaagagaagttatcggtacgctgatttatcgtcaggtacaaggtgcgattttt
atttcgacacgggcaaatcattttattcagggcttaaaaccgagccttttcaaaaacaag
acaaatgagcaattacttgctttttcccaagatgcacaagcgattatgcgagagttaaat
acgctgaaaatgccgattgtcgccgctatcgacgggaattgctttagtgtcggtctggaa
ctttccttagcttgcgattaccgtatcgccagtgatgaatcgcatactttctttgcgatg
ccgcaagtccgttccggcttattaccttttgccggcggtacgcaacgtttaccgcgttta
atcggtttacgttccgcgctaccgttaatgttattcggcgaaaaaataactgccgaaacc
gccaaaggattgggtttggttgatcgattggttcctaaaactcgtcttttaaccgatgct
tatcaactcttactagagaagaaaattcaaaaagccaatcataaaaaaccgcttactttc
tttaaaaaatggcgtaagcagatcgaaggtaattcgttcttacgcgaaaaattgcttgat
cgtacggaaaatgcgatttggcttaaaacgttcggtaattaccttgcggttgccaaactg
atggaactgctcaaagagccgcactttaaacaagggttaatgctcgaacaacaagccttt
gtcgaattgtttaatagcgcaacctcacaagtattaatcgaattaaagaaaaccgaacgg
gcaatgaaggataaatatcgtattcgaggtaatgtacgtgatgtcgctcaagtcagtatt
ttaggttcgggctatatgggcgccggtattgcttatttaaccgccaacaatgctaaagta
ccggttcgtataaaagatattcatccgtcggaaattcgtaaagccttacgtacctgcttt
gaattaatgcaaaaagcaacggataaaaatcagcttaatcacggtgaaatgatccaacgt
atgaatctgattaccggcggagagcgattagtggcggcaaaatcaaccgattttgtgatt
gaagcggtgtatgaagatctcaaacttaaacaacggatgttagccgaaagtgaaagctac
tatagtgaacaaaccatttttgcaacgaatacttcaacctttgcgattaaagatattgcg
gcttgtgcgattcgtccggaaaacgtaatcgggctacattatttcagcccggttaccacg
caaaaaatggtggaaatcataccgcatagcgcaaccggcgaacatacgattgcgacggcg
attcattttgccattcaacaaggcaaaatcccgttgttggttgccgataagcagggcttt
tttattaatcgagttttaacgccgttactgcttgaagcggtgcaatgtttaattgacggc
gaatcgattgaatttatcgatcgttcgttacaagaattcggcttcaaattaggcccgctt
gccatgatcgacgaaatggggctggatgtattggtcaaatcgaactcggctttagtcagc
gaattaggcagccgtttcagtttgcctcaagcggttgatttattgttccgaaatgaacgt
aaaggctgtaaaaacaaacgcggtttctatatgtatgatcgcttcggagaacgtttacag
gaagataaaagcatttatcacgtgatggaaaccattgcccgtaacgatttggaatccgaa
cagattgtccgccgttgcctgttacgtatgctcaacgaagcggcttggtgtttacaggat
aagattatcgcctcgaccgacgaaggtaatgtcgcttccgttctcgcaatgggctttccg
gagtttcgaggcggtatctatgcctatatcgaaaaaatcggtgcaaaagaaatcgtacgg
caattacgcttacacactaaacaatacggtaaacgtttcgaaccttgcgaatggctaatc
cgacaagccgaacaataa

DBGET integrated database retrieval system