KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_0900Help
Entry
APJL_0900         CDS       T00644                                 

Gene name
fadJ
Definition
fatty oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APJL_0900 (fadJ)
   01212 Fatty acid metabolism
    APJL_0900 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    APJL_0900 (fadJ)
   00650 Butanoate metabolism
    APJL_0900 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    APJL_0900 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    APJL_0900 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    APJL_0900 (fadJ)
   00310 Lysine degradation
    APJL_0900 (fadJ)
   00380 Tryptophan metabolism
    APJL_0900 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APJL_0900 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    APJL_0900 (fadJ)
   00281 Geraniol degradation
    APJL_0900 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    APJL_0900 (fadJ)
Enzymes [BR:apj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     APJL_0900 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     APJL_0900 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     APJL_0900 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
992991..995108
Genome map
AA seq 705 aa AA seqDB search
MTEQPIQQPMFQVEVDENQIAIIRIHSIDNDENWLPENFAGELREVIGTLIYRQVQGAIF
ISTRANHFIQGLKPSLFKNKTNEQLLAFSQDAQAIMRELNTLKMPIVAAIDGNCFSVGLE
LSLACDYRIASDESHTFFAMPQVRSGLLPFAGGTQRLPRLIGLRSALPLMLFGEKITAET
AKGLGLVDRLVPKTRLLTDAYQLLLEKKIQKANHKKPLTFFKKWRKQIEGNSFLREKLLD
RTENAIWLKTFGNYLAVAKLMELLKEPHFKQGLMLEQQAFVELFNSATSQVLIELKKTER
AMKDKYRIRGNVRDVAQVSILGSGYMGAGIAYLTANNAKVPVRIKDIHPSEIRKALRTCF
ELMQKATDKNQLNHGEMIQRMNLITGGERLVAAKSTDFVIEAVYEDLKLKQRMLAESESY
YSEQTIFATNTSTFAIKDIAACAIRPENVIGLHYFSPVTTQKMVEIIPHSATGEHTIATA
IHFAIQQGKIPLLVADKQGFFINRVLTPLLLEAVQCLIDGESIEFIDRSLQEFGFKLGPL
AMIDEMGLDVLVKSNSALVSELGSRFSLPQAVDLLFRNERKGCKNKRGFYMYDRFGERLQ
EDKSIYHVMETIARNDLESEQIVRRCLLRMLNEAAWCLQDKIIASTDEGNVASVLAMGFP
EFRGGIYAYIEKIGAKEIVRQLRLHTKQYGKRFEPCEWLIRQAEQ
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacaacccattcagcaaccgatgtttcaagtcgaagtagatgaaaatcagatt
gccatcattcgcattcactctattgataatgatgaaaactggcttcccgaaaattttgcc
ggcgaattaagagaagttatcggtacgctgatttatcgtcaggtacaaggtgcgattttt
atttcgacacgggcaaatcattttattcagggcttaaaaccgagccttttcaaaaacaag
acaaatgagcaattacttgctttttcccaagatgcacaagcgattatgcgagagttaaat
acgctgaaaatgccgattgtcgccgctatcgacgggaattgctttagtgtcggtctggaa
ctttccttagcttgcgattaccgtatcgccagtgatgaatcgcatactttctttgcgatg
ccgcaagtccgttccggcttattaccttttgccggcggtacgcaacgtttaccgcgttta
atcggtttacgttccgcgctaccgttaatgttattcggcgaaaaaataactgccgaaacc
gccaaaggattgggtttggttgatcgattggttcctaaaactcgtcttttaaccgatgct
tatcaactcttactagagaagaaaattcaaaaagccaatcataaaaaaccgcttactttc
tttaaaaaatggcgtaagcagatcgaaggtaattcgttcttacgcgaaaaattgcttgat
cgtacggaaaatgcgatttggcttaaaacgttcggtaattaccttgcggttgccaaactg
atggaactgctcaaagagccgcactttaaacaagggttaatgctcgaacaacaagccttt
gtcgaattgtttaatagcgcaacctcacaagtattaatcgaattaaagaaaaccgaacgg
gcaatgaaggataaatatcgtattcgaggtaatgtacgtgatgtcgctcaagtcagtatt
ttaggttcgggctatatgggcgccggtattgcttatttaaccgccaacaatgctaaagta
ccggttcgtataaaagatattcatccgtcggaaattcgtaaagccttacgtacctgcttt
gaattaatgcaaaaagcaacggataaaaatcagcttaatcacggtgaaatgatccaacgt
atgaatctgattaccggcggagagcgattagtggcggcaaaatcaaccgattttgtgatt
gaagcggtgtatgaagatctcaaacttaaacaacggatgttagccgaaagtgaaagctac
tatagtgaacaaaccatttttgcaacgaatacttcaacctttgcgattaaagatattgcg
gcttgtgcgattcgtccggaaaacgtaatcgggctacattatttcagcccggttaccacg
caaaaaatggtggaaatcataccgcatagcgcaaccggcgaacatacgattgcgacggcg
attcattttgccattcaacaaggcaaaatcccgttgttggttgccgataagcagggcttt
tttattaatcgagttttaacgccgttactgcttgaagcggtgcaatgtttaattgacggc
gaatcgattgaatttatcgatcgttcgttacaagaattcggcttcaaattaggcccgctt
gccatgatcgacgaaatggggctggatgtattggtcaaatcgaactcggctttagtcagc
gaattaggcagccgtttcagtttgcctcaagcggttgatttattgttccgaaatgaacgt
aaaggctgtaaaaacaaacgcggtttctatatgtatgatcgcttcggagaacgtttacag
gaagataaaagcatttatcacgtgatggaaaccattgcccgtaacgatttggaatccgaa
cagattgtccgccgttgcctgttacgtatgctcaacgaagcggcttggtgtttacaggat
aagattatcgcctcgaccgacgaaggtaatgtcgcttccgttctcgcaatgggctttccg
gagtttcgaggcggtatctatgcctatatcgaaaaaatcggtgcaaaagaaatcgtacgg
caattacgcttacacactaaacaatacggtaaacgtttcgaaccttgcgaatggctaatc
cgacaagccgaacaataa

DBGET integrated database retrieval system