KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1013Help
Entry
APJL_1013         CDS       T00644                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APJL_1013 (galM)
   00052 Galactose metabolism
    APJL_1013 (galM)
Enzymes [BR:apj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     APJL_1013 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117615..1118583
Genome map
AA seq 322 aa AA seqDB search
MKTFTLENSFLKITLSDFGAAWLSCVVKHPKGEREVLVTTSAENWQNQTAYFGATCGRYA
NRIANAEYQLNGKTYTLVKNDGKNTLHGGANGADKQIWQAEQLDPQAVKFSRIFADGEQG
FGGEVNAVVTYRLNGKEVEIEFEATANQDTPLCFTNHAYFNLLGAGDVLSHQLMINADEY
LPVGADGIPILPFKAVAHTGFDFSTPKLIGQDLLKDTDQQLVKGYDHAFKLVKNSAKPTA
CLTVEDLALELNTSMPALQCYSGNWLGGQPNLSGSTYQDYAGVALEPEFFPDSPNQAELA
KFGGITKAGERYKHDIRYTFHF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttaccctagaaaactcatttcttaaaattacgttatccgacttcggtgcc
gcttggctttcttgtgtggtgaaacacccgaaaggcgaacgtgaagtgttagttacgact
tctgcagaaaattggcaaaatcagaccgcttactttggagcaacttgcggacgttatgcc
aaccgtatcgctaatgccgaatatcagcttaacggcaaaacctatactttggttaaaaat
gacggtaaaaacactttacacggcggtgctaacggggcggataaacaaatttggcaagcg
gagcagcttgatccgcaagcggtcaaattcagccgaatttttgcagacggcgaacaaggt
ttcggcggtgaagtgaatgccgttgtgacttatcgtttgaatggaaaagaagtcgaaatt
gaatttgaagcaaccgccaatcaagataccccgctctgttttaccaatcacgcttatttc
aatttactcggcgcaggtgatgtgctttcgcatcaattgatgattaacgcagacgaatat
ttaccggtcggtgcagacggtatcccgattttaccgtttaaagcggttgctcacaccggt
tttgatttttcaacgcctaaacttatcgggcaagacttgctgaaagataccgatcaacag
ctggtaaaaggctacgatcacgctttcaaattggtaaaaaactctgcaaaaccgaccgct
tgtttaacggttgaagatcttgcacttgaactcaatacctcaatgccggcactacaatgc
tattcgggaaattggcttggcgggcaaccaaatctgagcggttcaacttatcaagattac
gccggtgttgctttagaaccggagtttttccccgattcgccaaaccaagccgaactggca
aaatttggtggcattaccaaagcaggcgaacgctataaacacgatattcgttacaccttt
cacttttaa

DBGET integrated database retrieval system