KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1014Help
Entry
APJL_1014         CDS       T00644                                 

Gene name
lacZ
Definition
beta-galactosidase/beta-glucuronidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:apj00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:apj00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1118608..1121628
Genome map
AA seq 1006 aa AA seqDB search
MILPNYFQDPNTLHVNTVEHHAYFIPHQQNETALSGKREQSDYFTLLNGQWDFNYFQSYH
DLPDNFLDIAFEHKIPVPANWQNHGFDHHHYTNINYPFPFDPPFVPHQNPCGVYHRTVQL
TPKSNKRYLLNFEGVDSCLFVYVNKQFVGYSQISHNTSEFDVSDYLQAGTNHLTVVVLKW
CDGSYLEDQDKFRMSGIFRDVYLLEREQNYLQDFFIQYELDDELRHANLKVETLFSRQPQ
AIEYQLLNPKGFTVFNQTDTHLNIEVEDIQLWNAEKPQLYTLILRTAEEVIVQKIGFRKV
EIKDGILLFNQQPIKFKGVNRHDSDPKTGYAISYAQAHKDLQLMKQHNINAIRTAHYPNA
PWFSELCDQYGFYLIGESDVESHGASMLTVKMPEPSILLNHQNDLQTERIRQDMIDNYCY
FARDPLFKKAILDRQQANVERDKNRTSIIIWSLGNEAGYGANFEAAAAWIKQRDKSRLVH
YESSIYQHSADNNDLSNLDFYSEMYGSTEDIDRYCATAQAKPFVLCEYSHAMGNSNGDAE
DYWQAFHRHPQSCGGFVWEWCDHAPYRANGQFGYGGDFGESPHDGNFCMDGLVSPDRIPH
SNLLELKNVNRPARAELIDNQIVIHNYLDFTDLADYLTIDYEFVENGVVTSGGNLSVSCQ
PHGSVVLPIELPKNNGHLWLLNLNYRLNTAVELLDEAHSLGFEQLNLFSENKLVLPKFTI
ENSAFEVQEDRFHINVHNGQFSYQLDKQKGIFNRIEKAGKAIIQQSLDFNIWRAPTDNDR
LIREAWQNAGYDKAYTRAYEIQWQQSEQAVEFSVKSAIVSISRGRILTLDIRYRIFNDGQ
LSVEINAIRPIELPYLPRFGLRFFLAKTENAIEYFGYGEQESYIDKRNLAKLGIYRITAK
QNHTNYVKPQETGSHYGCEYLKSENLFVSANQPFSFNLSPYTQEELTEKKHYYELQESDY
SVLCIDYKMSGIGSNSCGPNLKDQYRLMESEFKIRFDLIFDKTIRQ
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgatactgccgaattacttccaagatcccaatacgctccacgtaaataccgttgagcat
cacgcttattttattccgcatcaacagaatgaaaccgctttaagcggtaagcgcgaacaa
tccgattactttactttgcttaacggacaatgggattttaattacttccaaagctatcat
gacttgccggataatttccttgatattgcgtttgaacataaaattccggtgccggcaaat
tggcaaaatcacggttttgatcatcatcactatacgaatattaactacccgtttccgttt
gatccgccttttgtaccgcatcaaaatccatgcggcgtgtatcatcgtaccgtacaactt
accccgaaaagcaataagcgttatttgctcaattttgaaggcgtagattcctgtttattt
gtttatgtgaataaacagtttgtcggttatagtcaaattagccacaacacctccgaattt
gatgttagcgattatttacaagccggcaccaaccatttaaccgtcgtggtactgaaatgg
tgtgacggtagctatttagaagaccaagacaaattcagaatgtcaggcattttccgtgat
gtctatttgcttgagcgtgaacaaaattatctgcaagatttctttattcaatatgaattg
gatgatgaattacgtcacgcaaatctgaaagtggaaacactttttagccgtcagccgcaa
gcgattgaataccaattactcaacccgaaaggctttaccgttttcaatcaaaccgatacg
catctcaatattgaggtagaagatattcagttatggaatgccgaaaagccgcaactttac
accttaattttgcgtactgcggaagaagtgattgtgcaaaaaatcggttttagaaaagtg
gaaatcaaagacggcattttattatttaatcagcaaccgattaaatttaaaggagtaaac
cgccacgatagcgatccgaaaaccggttatgcgattagctacgcacaagcgcataaagat
ttacagctgatgaagcaacataatatcaatgcaatccgcactgcccattatccgaatgca
ccttggtttagtgagttatgcgatcaatacggtttttatttgattggcgaaagcgatgtc
gagtcacacggtgcgtcaatgctcaccgtcaaaatgcctgagccgagcattctcttaaat
caccaaaatgatttgcaaactgagcgtatccgtcaagatatgatagataattactgttac
tttgcccgtgatccgctgttcaaaaaagcgattttagaccgccaacaagccaatgtggaa
cgagataaaaatcgtacttcgattattatttggtcgttggggaatgaagccggctatggt
gccaattttgaagcggcggcagcgtggattaagcaacgtgataaatctcgtttagtgcat
tacgaaagctcgatttatcaacattccgccgataataatgatctatcgaatttggatttt
tatagtgaaatgtacggctcaaccgaagatatcgaccgctattgtgccactgcgcaagcc
aaacctttcgtgttgtgtgaatacagccatgcaatgggtaactcaaacggcgatgcggaa
gattattggcaagcgttccatcgtcatccgcaatcatgcggcggttttgtgtgggaatgg
tgcgatcacgccccttaccgtgctaacggacaattcggttacggcggtgatttcggcgaa
agtccgcacgatggaaatttctgtatggacggtttggtttcaccggatcgtattccgcac
agtaacttattagagcttaaaaatgtgaatcgccctgcacgtgccgaattaatcgataac
caaattgtgatccacaactacttggatttcactgatcttgccgattatttaacgattgat
tacgaatttgtcgaaaacggcgtggtgacaagcggtgggaatttatccgtttcttgccaa
ccgcacggcagcgtagtattaccgattgagttaccaaaaaataacgggcatttatggcta
ctgaatttaaattatcgcttaaataccgcggtcgaattattagacgaagcacattcactt
ggcttcgagcagctcaatttatttagcgaaaataaattagtattaccaaaattcacaatt
gagaacagtgcatttgaagtacaagaagatcgcttccacattaacgtacacaacggtcaa
tttagttatcaattagataaacagaaagggattttcaaccgtattgaaaaagccggtaaa
gcgattatccaacaatcgttagattttaatatttggcgtgcgccaaccgacaatgatcgc
ctcattcgtgaggcgtggcaaaatgccggctacgataaagcctataccagagcgtatgaa
attcagtggcagcaaagcgaacaagcggtcgaattttcagtaaaatctgcaattgtgtca
atttctcgcggtcgcattttaacactggatattcgttatcgtatcttcaatgacggacaa
ctttcggttgaaattaacgctattcgcccgatcgaattaccgtatttaccccgcttcggc
ttacgtttcttcttagctaaaacagaaaacgccattgagtatttcggttacggagaacaa
gaaagctatattgacaaacgcaatttagcaaaattaggcatctaccgtataacagctaaa
caaaatcataccaattatgtaaaaccgcaggaaaccggtagccattacggttgtgaatat
ctgaaatcggagaacctgtttgttagtgcgaaccagccattcagctttaatctctcgcca
tatacgcaagaagaattaacggagaaaaagcattattatgaactgcaagagtccgattac
agcgtattgtgtattgattacaaaatgagtggtatcggttcaaactcatgcggcccaaac
ttaaaagatcaatatcgcttaatggaaagcgaatttaaaataagatttgatctcatattt
gataaaaccatccgtcaataa

DBGET integrated database retrieval system