KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1027Help
Entry
APJL_1027         CDS       T00644                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APJL_1027 (hemD)
Enzymes [BR:apj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     APJL_1027 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1137875..1138588)
Genome map
AA seq 237 aa AA seqDB search
MLNQYQIFAIHQPLFTIEAGTELPQLPSVMSRLNTGDYVFAVSKHAIDFASETLIQTGFH
YRTDLKYFAVGRHSAAYFSAKTENPTYYPISSENSEGLLELPEMQILDGKNILILRAEKG
RDFFAEQASLRGANIQYLECYRRQYLADSITEKMSLCKRAGIDSIIVTSTDILITLYEQT
AEDDRQWLIECRLIVVSTRIAQLAYKLGWSRNKVLLSEKADNNSLLESVLKFIDKSN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatcagtatcagatttttgcgattcatcagccgttatttacgattgaagccggg
acggaattacctcagcttccgtcggtaatgtctcgtttgaataccggtgattatgtattt
gccgtgtctaagcatgcaattgattttgcctcggaaactttaatacagacaggatttcat
tatcgtacggatttaaaatattttgcggtaggtcggcattcggccgcttatttttcagca
aaaacagagaatccgacttactatccgatctcttccgaaaatagtgaggggttacttgaa
ttgcctgaaatgcaaatattagatggaaaaaatattttaatattgcgggcggaaaaaggg
cgagatttttttgcggaacaagcaagtttacgaggagcaaatattcaatatttagaatgt
tatcgccgtcaatatttagcagatagcattacggaaaaaatgagtttgtgtaaacgagcc
ggcattgatagtattattgtaaccagtacggatatcttaatcactttatatgaacaaacg
gcggaagacgatcgtcagtggttgattgaatgtcgtttaatcgtcgtcagcactcgtatt
gctcaactggcgtataaattaggttggagtagaaataaggttctactttcagaaaaagcg
gataataatagtctgctggaaagcgtattgaaatttatcgacaaatctaactaa

DBGET integrated database retrieval system