KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1130Help
Entry
APJL_1130         CDS       T00644                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    APJL_1130 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    APJL_1130 (nagZ)
Enzymes [BR:apj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     APJL_1130 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1253247..1254284
Genome map
AA seq 345 aa AA seqDB search
MLLIDIKDKELSQEEVEILEHPLVSGLILFSRNFHDKVQLEALVKSIRQRVKKPLLITVD
QEGGRVQRFREGFTKLPAMQAFHTLAKNPQESTALARQTGWLMAAEMFALDIDLSFAPVL
DLGHQCKAIGDRSFGENPDAMLPIAEAFIDGMREMGMATTGKHFPGHGHVLADSHLETPF
DDRPKEAIFNRDILPFKQLISKGKLSAVMPAHVIYTQCDSQPASGSEYWLKQVLRNQLNF
NGVIFSDDLGMKGAGFMGNFVERSEKAIHAGCDLLLLCNEPEGVIQVLDGLKYQPTKTQT
ERHISLMKRKTVRWNELEASPRYQQAQQRLTALQNEWLEYKAQHC
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgttattgattgatataaaagataaagaactcagccaagaagaagttgaaattcttgaa
catccgctcgtatccggcttaattttatttagccgtaattttcacgataaagtccaattg
gaagccttagtgaaatcgattcgccaacgggtaaaaaaaccgttattgattaccgtcgat
caagaaggcggtcgagtacaacgcttccgtgaaggctttactaagttgccggcaatgcaa
gcgtttcatacccttgcaaaaaacccgcaagaatcgaccgctttagcccgacaaaccggt
tggttaatggcggctgaaatgtttgccttagacatcgacttgagttttgcaccggtctta
gatttagggcatcagtgcaaagcgattggcgatcgttcgttcggtgaaaatccggatgcg
atgctaccgatagccgaagcctttatcgacggtatgagagaaatgggtatggcgaccacc
ggtaaacatttccccggtcatggacatgtattagccgactctcatttagaaacgcctttt
gatgatcgtccgaaagaggcgattttcaaccgtgatattctgccgtttaaacaacttatt
tcaaaaggtaaactgtccgcggttatgccggctcacgtaatttatacgcaatgtgacagc
caaccggcaagcggatcggaatattggttaaaacaagttttacgtaaccaacttaacttt
aacggcgtgattttttccgatgatttaggtatgaaaggcgccggttttatgggtaatttt
gtagaacgttctgagaaagcgattcacgccggttgtgatttactgctgctctgtaatgaa
ccggagggagttatccaagtattagacggtttaaaatatcaaccgactaaaacgcaaacc
gaacgccatatctccttgatgaaacgtaaaacggtacgttggaacgagcttgaagcgagt
cctcgttatcagcaagcgcagcaacgtttaaccgcattacaaaacgagtggcttgaatat
aaagcgcagcactgctaa

DBGET integrated database retrieval system