KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1143Help
Entry
APJL_1143         CDS       T00644                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    APJL_1143 (pfkA)
   01230 Biosynthesis of amino acids
    APJL_1143 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APJL_1143 (pfkA)
   00030 Pentose phosphate pathway
    APJL_1143 (pfkA)
   00051 Fructose and mannose metabolism
    APJL_1143 (pfkA)
   00052 Galactose metabolism
    APJL_1143 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    APJL_1143 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    APJL_1143 (pfkA)
Enzymes [BR:apj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     APJL_1143 (pfkA)
Protein phosphatases and associated proteins [BR:apj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     APJL_1143 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1265128..1266102)
Genome map
AA seq 324 aa AA seqDB search
MAKQIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGVQDGYYGLYTDRVIPLDRRS
VSETINRGGTFLGSARFPQFKDPDVRKKSVETLKKYDIDALVVIGGDGSYMGAKLITEEF
GYPCIGIPGTIDNDIVGTDYTIGYQTALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALASGCEYIIVPEKGLDKESLMRNIEDGFNKGKRHAIIAITELMTDVQALAKEIE
DRFGHETRATVLGHIQRGGAPCPFDRILASRMGVYAVDLLLQGHGGRCIGIKNENLVHHD
IIDAINNMRRPFKEELFEAARKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacaaatcaaaaaaattgccgtgctaaccagtggaggtgatgcaccgggtatg
aatgccgcaattcgtggtgtggtacgcgccgcattaaacgaaggcttagaagtatatggc
gtacaagacggttattacggtttatataccgatagagtaattccgcttgatcgtcgttcc
gtatcggaaacgatcaaccgcggcggtacttttttaggttcggcgcgcttcccgcagttt
aaagatcctgacgtacgtaaaaaatcggtagaaaccttaaaaaaatacgatattgatgcg
ctggtcgttatcggcggagacggctcgtatatgggagcgaaacttataaccgaagaattc
ggttatccgtgtatcggtattccgggtacgatcgataatgatatcgtcggtacggattat
actatcggttaccaaaccgcattggaaacggcggtggaagcgattgaccgtttacgcgat
acttctacctcgcatcagcgtatttcaatcgttgaaattatgggacgccactgcggcgat
ttaaccattagtgcggcgcttgccagcggttgcgaatatattatcgtgccggaaaaaggt
ttggataaagagtcgctaatgcgtaatatcgaagacggttttaataaaggtaaacgtcat
gcgattattgcgattaccgaattaatgacggacgttcaggcattggcaaaagaaatcgaa
gaccgcttcggtcatgaaacgcgcgcaaccgtattaggtcacattcaacgtggcggtgca
ccttgcccgttcgaccgtattttagcttcccgtatgggcgtatatgcggtggatctgtta
ttacaaggtcacggcggtcgttgtatcggtatcaaaaatgagaatttggtacatcacgat
attattgatgcgattaacaatatgcgccgcccgttcaaagaagaactgtttgaggcggct
agaaaattattctaa

DBGET integrated database retrieval system