KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1252Help
Entry
APJL_1252         CDS       T00644                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    APJL_1252 (malQ)
Enzymes [BR:apj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     APJL_1252 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1375841..1377859
Genome map
AA seq 672 aa AA seqDB search
MKSLHPYLNPYFFDEYGRRRYASQAVCHKIAKRLGSPKSKPIIPPVKVATEGQAVYIRLN
LANSNKALQARWQLHLENGEIRCGKVKRNAINLPKDLPLGYHHLQLKSEHYSLNCRLIIT
PKTAFQPKELQQKQKLWGAILQLYTLRSEHNWGIGDFSDLKTFLSRLAEKGGDFVGLNPI
HAIFPANPESASPYSPSSRLWQNIIYIDVAAIDAFQQSSEAQAWFHSAEVQQQLIEARAK
DYVDYSQVMGLKLEGLRLAYATFVQQDQQAFEQFINEYGESLKVQGTFDALHYWLSSQFS
EQWGWNFWAQEYQDYASNAVQTFQTEHSQLVRFYMWLQFVAQQQLRACNQLAKALNMPIG
FYRDLAVGVADNGAETWADKELFVLDASVGAPPDIMAPNGQNWGLSPMHPEVLQARGYQP
FIDLLRANMKDCGALRIDHILGFARMWWVAKGDSAKNGAYVRYPLEDLLAILALESQRNQ
CLIIAEALGTVPKGMLQKLEDKGILAYNIFYFEWDQHGSKPLANYPYQAMTTLSTHDLPT
LQGYWKGYDFDLGKKFGVYPSEKVLNILKQSRHFNKEAIRQAVEKVQDLAKDSEGVNLKF
VHQLQMYVADTNSALFGTQPEDWLNMLEPVNIPGTSNEYPNWRRKLSHTINEIFNHEQIN
QLLDAFEQKRNK
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgcttcacccataccttaatccttatttctttgatgaatatggcagacgccgt
tatgccagccaagcggtctgtcacaaaattgcaaaacgcttaggttctcctaaaagcaaa
cctattattcctcctgtaaaggtagcaacagaaggacaagcggtctatattcgactaaat
cttgcaaatagcaataaagcattacaagctcgctggcaacttcacttagaaaacggtgaa
atacgttgcggtaaagtaaaacgtaatgcgatcaatttaccgaaagatctgcctctcggc
tatcatcatttacagcttaaaagtgagcattattcactgaactgccgcctgattattacg
ccgaaaactgctttccagccaaaagaattacaacaaaaacaaaaattatggggcgcaatt
ttacaactctatacgcttcgttccgaacataattggggcatcggcgattttagcgatttg
aaaaccttcttaagtcgacttgctgaaaaaggtggtgattttgttgggctaaatccaatt
catgcgattttcccagccaatccggaaagtgccagcccttatagcccctcatctcgttta
tggcaaaacattatttatatcgatgtagcagcgattgatgccttccaacaatctagcgaa
gcgcaagcctggtttcattccgcagaagttcaacaacagcttattgaggcaagagcaaaa
gactacgtagattattcgcaagtgatgggcttaaaactcgaaggattacgtttagcctat
gccactttcgttcagcaagatcaacaagctttcgaacaatttatcaatgaatacggcgaa
agcctaaaagtgcaaggtacattcgacgcactacattattggttatccagccaatttagc
gagcaatggggttggaatttctgggcgcaagaatatcaagactacgcatcaaatgcagta
cagacattccaaacggaacatagccaattagttcgtttctatatgtggttgcaatttgtg
gctcaacagcaattaagagcgtgtaatcaattggcaaaagcactcaatatgcctatcggc
ttttaccgtgatttagcggtaggcgttgccgataacggtgcggaaacttgggcggataaa
gagttatttgtgctagatgcctctgtcggtgcaccaccggatattatggcaccaaacgga
caaaactggggcttatcaccgatgcatccggaagtgctacaagctagaggataccagcca
tttattgatttattacgtgccaatatgaaagattgcggtgcattacgtatcgaccacatt
cttggttttgcacgtatgtggtgggtggcaaaaggcgattcggctaaaaacggcgcttat
gtacgttatccgctagaagatttgttagcaattcttgcgttagaaagtcagcgaaatcag
tgtttaatcattgctgaagcacttggtacagtaccgaaaggtatgctacagaaattagaa
gacaaaggtattctcgcttataacattttctattttgaatgggatcaacacggcagtaag
ccattagctaattatccatatcaagcgatgacgacactcagtacgcatgatttaccaacc
ctacaaggctactggaaaggctacgactttgatttaggcaagaaatttggtgtttaccca
agtgagaaagtgcttaatattctgaaacaaagtcgccatttcaataaagaagcgattaga
caagcggtcgaaaaagtccaagatcttgcaaaagatagcgaaggcgtaaacttaaaattt
gtacatcaattacaaatgtatgtagcggataccaattctgctttatttggcactcagccg
gaagattggctaaatatgctcgagccggtaaatattcccggaacaagtaatgaatatccg
aattggcgtagaaaattaagccatacaattaatgagattttcaaccatgagcaaatcaat
caactacttgatgctttcgaacaaaaacgaaataaataa

DBGET integrated database retrieval system