KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1397Help
Entry
APJL_1397         CDS       T00644                                 

Gene name
mauG
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1538346..1539746
Genome map
AA seq 466 aa AA seqDB search
MKKYLLSAIAAAGIGYFSLVGYAYWFDKEQAPKLLASADLPESHKAVAGVMFENGCQYCH
SANAELPAYAKLPIADQVMAEDIEKGLKFFRLDHLIEGMKDPSKLSEADLAKLEQVIRND
EMPVAKYIHIHWGSRPDEAQKKIILDWVTAQRQAHFLPKAEGADATRLVQPIPDQLPTDP
HKVALGEGLYFDGRLSDDGTIQCHTCHQLAQAGVDNLPVSEGINGLKGGINAPTVFNAAF
NKWQFWDGREKTLADQAGGPPVNPVEMGSKNWDEILARLSKDEEFMKRFHEIYPTLTQAN
VTDAIGEYEKTLITPNSAFDRFLKGEQNALTDVQKRGYEHFKNAKCDTCHTGTAMGGQSF
EYMGLYADYFKDRGTELTEADHGRYAVTKDPSDMHRFKVPTLRNVALTAPYMHDASAKDL
KEAVRIMGIYQSNKQFSETELNELVAFLESLTGEYKGKLLTNEKVK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttactttcggcaattgccgccgccggcatcggctatttttcacttgtg
ggctacgcctattggtttgataaagagcaagcgccaaaattattagcgtccgcagactta
cccgaatcgcataaagcggtcgcaggagtcatgtttgaaaacggctgccaatattgccac
tcggctaatgcggaattaccggcttatgccaagttaccaatcgcagaccaagtgatggct
gaagatattgaaaaaggtcttaagttcttccgtcttgatcatctgattgaaggaatgaaa
gatccgagcaaactttcagaagccgatcttgctaaattagaacaagtaattcgcaatgac
gaaatgccggttgctaaatatattcatatccactggggttctcgtcctgacgaagctcag
aaaaaaattatcttagattgggttaccgcacaacgccaagcacacttcttaccaaaagcg
gaaggtgcggacgctactcgcttggttcagccgattcctgatcaattaccgaccgatccg
cataaagtagctttaggtgaagggctttattttgacggacgtttatctgatgacggtacg
attcaatgccatacttgccaccaattagcgcaagccggggtcgataacttaccggtatcg
gaagggattaacggcttaaaaggcggtatcaacgcgcctacggtgtttaatgcggcattt
aataaatggcaattctgggacggtcgtgagaaaaccttagcggatcaagcgggcggccca
ccggtaaacccagttgaaatgggttcaaaaaactgggatgaaattctcgccagactaagc
aaggacgaagaatttatgaaacgtttccacgagatttacccgactcttacgcaagcgaac
gtcaccgatgcaatcggtgaatatgaaaaaacgcttattacgccgaacagtgcattcgac
cgcttcttaaaaggcgagcaaaatgcgctaaccgatgtacaaaaacgcggttacgagcat
ttcaaaaatgcgaaatgcgatacttgccataccggtacggcaatgggcggacaatcattt
gaatatatgggcttatatgccgattacttcaaagatcgcggtacggaattaaccgaagcg
gatcacggtcgttatgcggtaactaaggatccaagcgatatgcaccgtttcaaagtgccg
actttacgtaacgtggcgttaactgcaccatatatgcacgatgcaagtgcgaaagactta
aaagaagcggttcgtattatgggtatttaccaaagcaataaacaattctctgagacagag
cttaatgagctagttgctttcttagaatcactgaccggtgaatataaaggcaaattacta
actaatgaaaaagtgaaataa

DBGET integrated database retrieval system