KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1524Help
Entry
APJL_1524         CDS       T00644                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apj01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:apj00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:apj00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675919..1677199
Genome map
AA seq 426 aa AA seqDB search
MNLYNIKHPEEQVNFAQGVRQGLGKDQGLFFPEVLPKFDDIEALLDLPLVERSQKILAAL
IGNELPQETVNAMVKNAFTFPAPLAKVNDDIYALELFHGPTLAFKDFGGRFMAQALASVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
ESDFDACQVLVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKAKRSDVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLKSGKWEPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALSDLGSAALNDAETEAALKAQYAEGYLCEPHGAIAYQALK
DQLQAGETGIFLCTAHPAKFKESVERILNIELPLPEALDKHNKMELLSDTMPADFAKLRE
YLLAGN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatacaacatcaaacacccagaagaacaagttaatttcgcacaaggcgtgcgc
caaggtttaggtaaggatcaggggttatttttccctgaagtgttaccgaaatttgacgat
atcgaggcgttactggatttacctttggttgaacgcagccaaaaaattttggcggcactt
atcggtaacgaacttccgcaagaaacggtaaatgccatggtaaaaaatgcgtttactttc
cctgctccattagcaaaagtgaatgacgatatttatgcacttgagctgttccacggtccg
acattagcgtttaaagacttcggcggtcgttttatggcacaagcactggcaagcgtgcgt
ggtgacggcaaaatcaccattttaaccgcaacctcaggcgacaccggtgcggcggtagcg
cacgcattttatggcttagaaaatatcaatgtagtgatcctttacccgaaaggcaaaatc
agcccgttacaagaaaaattattctgtaccttaggcggtaacattcgtaccgttgcgatt
gaatcggattttgacgcttgccaagtgttagtaaaacaagcgtttgacgatgctgaatta
cgtcaagcgatcggcttaaactccgcaaactcaatcaatatcagccgtttattagcgcaa
gtttgttattactttgaagcggtagcacaattaccgaaagcaaaacgttctgacgtagtg
gtttcagtaccaagcggtaacttcggtaacttaaccgcaggtttaatcgcaaaaacctta
ggtttaccaattaaacgttttatcgcatcaaccaatgcgaatgacacagtgccgcgttat
ttaaaatcaggtaaatgggaaccgaacgcaacggtagcaacgctttcaaacgcaatggac
gtaagccgcccgaacaactggcctcgtgtggaagaattatttaaacgcaacggttgggcg
ttaagcgatttaggttcggcggcattaaacgatgcggaaaccgaagcagcattaaaagca
caatatgcggaaggttatttatgcgaaccgcacggtgcaatcgcttaccaagcgttaaaa
gatcagcttcaagcgggcgaaaccggtattttcctctgcaccgctcacccggcaaaattc
aaagaaagcgtagaacgtattcttaacatcgaattaccactaccggaagcattggataaa
cataacaaaatggaattattatccgacactatgccggcggatttcgccaaattacgtgag
tatttgttagcgggtaactaa

DBGET integrated database retrieval system