KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1524Help
Entry
APJL_1524         CDS       T00644                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    APJL_1524 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APJL_1524 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    APJL_1524 (thrC)
Enzymes [BR:apj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     APJL_1524 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675919..1677199
Genome map
AA seq 426 aa AA seqDB search
MNLYNIKHPEEQVNFAQGVRQGLGKDQGLFFPEVLPKFDDIEALLDLPLVERSQKILAAL
IGNELPQETVNAMVKNAFTFPAPLAKVNDDIYALELFHGPTLAFKDFGGRFMAQALASVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
ESDFDACQVLVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKAKRSDVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLKSGKWEPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALSDLGSAALNDAETEAALKAQYAEGYLCEPHGAIAYQALK
DQLQAGETGIFLCTAHPAKFKESVERILNIELPLPEALDKHNKMELLSDTMPADFAKLRE
YLLAGN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatacaacatcaaacacccagaagaacaagttaatttcgcacaaggcgtgcgc
caaggtttaggtaaggatcaggggttatttttccctgaagtgttaccgaaatttgacgat
atcgaggcgttactggatttacctttggttgaacgcagccaaaaaattttggcggcactt
atcggtaacgaacttccgcaagaaacggtaaatgccatggtaaaaaatgcgtttactttc
cctgctccattagcaaaagtgaatgacgatatttatgcacttgagctgttccacggtccg
acattagcgtttaaagacttcggcggtcgttttatggcacaagcactggcaagcgtgcgt
ggtgacggcaaaatcaccattttaaccgcaacctcaggcgacaccggtgcggcggtagcg
cacgcattttatggcttagaaaatatcaatgtagtgatcctttacccgaaaggcaaaatc
agcccgttacaagaaaaattattctgtaccttaggcggtaacattcgtaccgttgcgatt
gaatcggattttgacgcttgccaagtgttagtaaaacaagcgtttgacgatgctgaatta
cgtcaagcgatcggcttaaactccgcaaactcaatcaatatcagccgtttattagcgcaa
gtttgttattactttgaagcggtagcacaattaccgaaagcaaaacgttctgacgtagtg
gtttcagtaccaagcggtaacttcggtaacttaaccgcaggtttaatcgcaaaaacctta
ggtttaccaattaaacgttttatcgcatcaaccaatgcgaatgacacagtgccgcgttat
ttaaaatcaggtaaatgggaaccgaacgcaacggtagcaacgctttcaaacgcaatggac
gtaagccgcccgaacaactggcctcgtgtggaagaattatttaaacgcaacggttgggcg
ttaagcgatttaggttcggcggcattaaacgatgcggaaaccgaagcagcattaaaagca
caatatgcggaaggttatttatgcgaaccgcacggtgcaatcgcttaccaagcgttaaaa
gatcagcttcaagcgggcgaaaccggtattttcctctgcaccgctcacccggcaaaattc
aaagaaagcgtagaacgtattcttaacatcgaattaccactaccggaagcattggataaa
cataacaaaatggaattattatccgacactatgccggcggatttcgccaaattacgtgag
tatttgttagcgggtaactaa

DBGET integrated database retrieval system