KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1704Help
Entry
APJL_1704         CDS       T00644                                 

Gene name
rbsK2
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APJL_1704 (rbsK2)
Enzymes [BR:apj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     APJL_1704 (rbsK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1860544..1861455
Genome map
AA seq 303 aa AA seqDB search
MKKLCVLGSVNADHVIRVPYFPKAGETLKGGHYHIAYGGKGANQAVAAARVRNTSLVEVD
FIACIGADDIGRAMKQAFVQDGINPEHIVEVADQMTGIAMIQVADSGENSIVISAGANAN
LDESVVAQHQATIERADCLLVQLETPLQAVEKALKIAKANHTQVILNPAPAQPLSDEILA
NIDMITPNETETALLTGIQVVDEQTAQQAANVFHQKGIQTVLITLGAKGAFLSENGNGEI
IAGFKVTPVDTTAAGDTFNGALAIALLEGKSMRDAVMFAHKASSISVTRMGAQSSIPTRA
ELV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttgtgtgttgggcagcgtaaatgcggatcacgttattcgagtgccttat
ttcccgaaagcgggcgaaacgctgaaaggcggtcattatcacattgcgtatggcggcaaa
ggggctaatcaggcagtagcggcggctcgtgtgcgaaatacatcgttagttgaggtggat
tttatcgcttgtatcggcgctgatgatattggacgagcgatgaaacaagcctttgtgcaa
gacggaattaatcccgaacacattgttgaagtagctgaccaaatgaccggcattgcgatg
attcaagtggcggattcaggcgagaatagcattgtaatttccgccggtgcaaatgcaaac
ttagatgaaagcgtggtggcacaacatcaagctacgattgaaagagcggattgcttactg
gttcagctggaaacgccgttacaagcagtcgaaaaagcgttaaaaattgctaaggcaaat
catactcaagtcattttaaatccggcaccggcacaaccgctctcggatgaaattttggcg
aatatcgatatgattaccccaaacgaaacggaaactgccttactgacaggcattcaagtg
gtcgatgaacaaaccgctcaacaagcagcgaatgtgttccatcaaaaagggattcaaacc
gtgttaattactttgggggcgaaaggggcgtttttaagtgaaaacggtaacggtgaaatc
attgccggctttaaagtcacaccggtggacaccaccgccgccggcgatacctttaacggc
gcattggcgattgctttattagaaggcaaatcaatgcgagatgcggtcatgtttgcccac
aaagcctcttcgatttcagtcactcgtatgggtgcacaaagttcgattccaactcgagcg
gaattagtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system