KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1719Help
Entry
APJL_1719         CDS       T00644                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    APJL_1719 (fucA)
Enzymes [BR:apj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     APJL_1719 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1878519..1879169
Genome map
AA seq 216 aa AA seqDB search
MNRRELARQIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGTPYEQMTEDSIVYVDK
DGKHEEGMLPSSEWQFHLAVYEARPELNAVVHNHALNCAAASILGEDIPAIHYMIACTGT
DHIPCVPYATFGTHKLADYVREGIKQSKAILLAHHGLITADKTLDKALGIAHEVEVIAEW
YLKLLATGRPLPTLSKEEMQTVLEKFKSYGSWVEEK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcagagaactggctcgacaaattatcgatacttgccttgaaatgacacgtctc
ggtttaaaccaagggacggcaggtaatgttagcgtacgttatcaagacggtatgctgatt
accccgaccggtactccgtacgaacaaatgacggaagatagcattgtttatgtagataaa
gacggtaaacacgaagaaggaatgctcccgtcaagcgaatggcaattccatttagcagta
tatgaagcgcgtccggaattaaatgcggtggtgcataaccacgcattgaattgtgccgcc
gcttctatcctcggcgaagatattccggctattcactatatgattgcttgtaccggaacc
gatcatattccatgcgtaccttatgcgacgttcggcactcataaattagccgattatgtg
cgtgaagggattaagcaaagtaaagcgattttactggcgcatcacggcttaattaccgca
gataagaccttggataaagcattaggtatcgctcacgaagttgaagtaattgcagagtgg
tatctaaaactgcttgcaacaggtagaccgcttccgactttatctaaagaagaaatgcaa
accgtattggaaaaattcaaatcttacggttcttgggtcgaagaaaaataa

DBGET integrated database retrieval system