KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1917Help
Entry
APJL_1917         CDS       T00644                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apj01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:apj00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2068952..2070085)
Genome map
AA seq 377 aa AA seqDB search
MKNNIINLAQDLIRRPSISPADQGCQQVIAERLAQLGFTLEWLPFGDTLNLWAKHGSGSP
VVAFAGHTDVVPVGDETQWTYPPFEARIVDNMLYGRGAADMKGSLSALVVAAEEFVKANP
NHTGTVALLITSDEEAAAKDGTVKVVETLMARGEPIHYCVVGEPSSGKVLGDVIKNGRRG
SITGELYIEGVQGHVAYPHLAENPVHTSLNFLTELTTYQWDNGNEFFPPTSLQIANIKAG
TGSNNVIPGELYVQFNLRYCTEVTDEIIKNKVAEMLAKHQLKHRISWNLSGQPFLAGNGE
LVKATVQAVENVTKITPRLDTSGGTSDGRFIALMGAEVVEFGPLNATIHKVNECVSVEDL
GKCGEVYYHILERLLKS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaacatcatcaaccttgcacaagatttaattcgtcgtccgtccattagtccg
gctgatcagggctgccaacaagtgatagcggaacgcttggcacaattaggctttacactc
gaatggttgcctttcggagatacgctgaatttatgggcgaaacacggtagcggcagtccg
gtagtcgcatttgccggacataccgatgtggtgccggttggtgatgaaactcaatggact
tatcctccgtttgaagctcgtattgtggataatatgctttacggacgtggtgcggcggat
atgaaaggttcgctttccgcattggttgtggcagcggaagagtttgttaaagcaaacccg
aatcataccggcacggttgcattattaattacctccgatgaagaggcggcagcaaaagac
ggcacggtaaaagtagtagaaacactaatggcaagaggcgaaccgattcactattgcgtt
gtaggcgaaccttctagcggcaaagtgttaggcgatgtgattaaaaacggcagacgaggc
tcaattaccggtgaactttatattgaaggtgtgcaaggtcatgtcgcttatccgcattta
gctgaaaatccggtacatacttcattgaatttcttaaccgaattaactacttatcaatgg
gataacggcaatgaatttttcccaccgaccagtttgcaaatcgctaatattaaagcggga
acaggcagtaataatgttattccgggcgaattatacgtgcaatttaacttacgctattgc
accgaagtgaccgatgaaattatcaaaaacaaagtggcggaaatgttagctaaacatcag
ctaaaacaccgtattagttggaatttatccggtcagccgtttttagccggtaatggagaa
ttggttaaagcgacggtacaggcggtcgaaaacgtcacaaaaattacccctcgtttagat
acgagcggagggacttcagacggtcgctttatcgcattaatgggtgcggaagtggtcgag
ttcgggccgttaaacgcgactattcataaagtgaatgaatgtgtcagcgtagaagacctt
ggtaaatgcggagaagtgtactatcacatcctcgaacgtttacttaaaagttaa

DBGET integrated database retrieval system