KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_1972Help
Entry
APJL_1972         CDS       T00644                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
apj00010  Glycolysis / Gluconeogenesis
apj00051  Fructose and mannose metabolism
apj00562  Inositol phosphate metabolism
apj01100  Metabolic pathways
apj01110  Biosynthesis of secondary metabolites
apj01120  Microbial metabolism in diverse environments
apj01130  Biosynthesis of antibiotics
apj01200  Carbon metabolism
apj01230  Biosynthesis of amino acids
Module
apj_M00002  Glycolysis, core module involving three-carbon compounds
apj_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APJL_1972 (tpiA)
   00051 Fructose and mannose metabolism
    APJL_1972 (tpiA)
   00562 Inositol phosphate metabolism
    APJL_1972 (tpiA)
Enzymes [BR:apj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     APJL_1972 (tpiA)
Exosome [BR:apj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   APJL_1972 (tpiA)
  Exosomal proteins of bladder cancer cells
   APJL_1972 (tpiA)
  Exosomal proteins of melanoma cells
   APJL_1972 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABY70520
UniProt: B0BTK6
Position
complement(2129914..2130684)
Genome map
AA seq 256 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIAGLKAELADVKGCDVAIAPPVMYLAEAEAALAGQSV
IALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKECDTFIAKKFAALKA
AGLVPVLCIGETEAENEAGQTEAVCAKQIDAVIDALGVEAFNGAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRGHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLK
APAFAVIVKAAEKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccacttgtaatgggtaactggaaattaaacggtagcaaagcatttaca
aaagagttaatcgccggcttaaaagcggaattggcggatgttaaaggctgtgacgttgca
atcgcgccgccggtaatgtacttagcggaagcggaagcggcattagcgggtcaatcagtc
atcgcattaggcgcacaaaacgtagacgtaaacgtacaaggtgcatttaccggtgatatt
tcaaccgaaatgttaaaagacttcggtgcaaaatatattattatcggtcactccgagcgt
cgtacttatcacaaagaatgcgatacgttcattgcgaaaaaattcgctgcgttaaaagcg
gcgggtttagtaccggtattatgtatcggtgaaaccgaagcggaaaacgaagcgggtcaa
accgaagcggtatgcgcaaaacaaattgatgcggtaatcgatgcgttaggcgttgaagcg
tttaacggtgcggtaatcgcctacgaaccgatttgggctatcggtaccggtaaatccgca
actcctgcgcaagcgcaagcggttcacgcattcatccgcggtcacattgcagcgaaatca
caagcggttgcggatcaagtgattatccaatacggcggttcggtaaacgatgcgaatgcg
gcggaattattcactcagccggatatcgacggtgcgttagtcggcggtgcgtcattaaaa
gcgcctgcatttgcggttatcgtcaaagcggcggaaaaagcgaaagcgtaa

DBGET integrated database retrieval system