KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_2006Help
Entry
APJL_2006         CDS       T00644                                 

Gene name
adh3
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    APJL_2006 (adh3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APJL_2006 (adh3)
  Lipid metabolism
   00071 Fatty acid degradation
    APJL_2006 (adh3)
  Amino acid metabolism
   00350 Tyrosine metabolism
    APJL_2006 (adh3)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    APJL_2006 (adh3)
   00626 Naphthalene degradation
    APJL_2006 (adh3)
Enzymes [BR:apj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     APJL_2006 (adh3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2157626..2158675
Genome map
AA seq 349 aa AA seqDB search
MMKMRAAVVAPQCDGTVEIVERDIPEIKNGEALVEVEYCGVCHTDLHVAAGDYGKKPGRI
LGHEGIGIVKSIAPDVTNLKVGDRVSIAWMFESCGSCEYCTTGRETLCRSVKNAGYTVDG
GMATHCVVTADYAVKVPDGLDPAQASSITCAGVTTYKGIKVSGVRAGQWIAIYGAGGLGN
LAVQYAKKVFGARVIAIDINDDKLAFAKEVGADLTINPLKEDSVQVIQEKVGGAHAAVVT
AVSKVAFNAAVNCVRAGGRVVAIGLPPETMDLSIPRIVLDGIEIVGSLVGTRQDLAEAFQ
FGAEGLVVPLVQLRRLDEANDIFQEMRDGKIQGRMVIDMKKGCGCGCSH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatgcgtgctgctgtggttgccccacaatgtgatggaacagttgaaattgtt
gaacgtgacattccggaaatcaaaaatggcgaagcccttgttgaagttgaatattgcggc
gtatgtcataccgatttacacgtcgctgccggcgattacggtaaaaaaccgggtcgtatc
ttaggccacgaagggatcggtatcgttaaatcgatcgcaccggatgtgactaatttaaaa
gtcggtgatcgtgtcagtattgcatggatgttcgagagctgcggctcgtgcgaatattgc
actaccggacgtgaaacgctttgccgtagcgtgaaaaatgccggctatacggtggacggc
ggtatggcgacgcactgtgtcgtaacggcagattatgcggtaaaagtaccggacggtttg
gatccggcacaagcaagtagtatcacttgcgccggtgtaaccacttataaagggattaaa
gtctcgggcgtacgtgcgggacaatggattgcgatttacggtgccggcggtttaggcaac
ttggcggtgcaatatgcgaagaaagtattcggcgcacgtgtgattgcaatcgatattaat
gatgacaaactggcgtttgccaaagaagtcggtgcggatttaaccattaacccgttgaaa
gaagacagcgtacaagtgattcaagaaaaagtcggcggtgcgcatgcggcggttgtgacg
gcggtatctaaagtggcgtttaacgctgcggtgaactgcgttcgagcaggcggtcgcgtg
gtggctatcggtctgccgccggaaaccatggatctctctatccctcgtatcgtattggac
ggtatcgaaattgtcggctcgttggtcggtactcgtcaagatcttgccgaggcgttccaa
ttcggtgcggaaggtttagtagtaccgttagtgcaattacgtcgcttggacgaagcgaat
gacattttccaagaaatgcgtgacggtaaaattcaaggtcgaatggtgatcgatatgaaa
aaaggctgcggttgcggttgtagtcactaa

DBGET integrated database retrieval system