KEGG   Actinobacillus pleuropneumoniae JL03 (serotype 3): APJL_2036Help
Entry
APJL_2036         CDS       T00644                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
apj  Actinobacillus pleuropneumoniae JL03 (serotype 3)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:apj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    APJL_2036 (hemB)
Enzymes [BR:apj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     APJL_2036 (hemB)
Exosome [BR:apj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   APJL_2036 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2181582..2182601
Genome map
AA seq 339 aa AA seqDB search
MTQYLNTSFPTRRMRRLRKHDFSRRLVAESQLTAGDLIYPVFVIEGENQRVKVPSMPSVE
RLTIDQLLIEAGELVKYGVPAIALFPVVGNEKKSLMAEEAYNPEGLAQRAVRALKAAYPE
LGVMTDVALDPFTTHGQDGIIDEEGYVLNDITTEVLVKQAVSHAEAGADIVAPSDMMDGR
IGKIREALEAKGLINTQIMAYSAKYASNYYGPFRDAVGSAGNLKGGNKFTYQVDPANANE
GLHEVAMDIQEGADMVMVKPGMPYLDMVWRVKETFGVPTFAYQVSGEYAMHMAAIQNGWL
KERECVMEGLLCFKRAGADGILTYFAKTVAKWLYEDNRK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatatcttaacacttcatttcccactcgccgtatgcgtcgtttacgtaaacat
gatttcagccgtcgtttagtggcggaaagtcaattgactgccggcgatttaatttatccg
gtatttgtgattgaaggcgaaaatcagcgagtaaaagtaccgtctatgccgagtgtagaa
cgtttaaccatcgatcaattattaattgaagccggcgaattggtcaaatacggcgtacct
gcaatagctcttttcccagtagtaggtaatgagaaaaaatctctgatggcggaagaagcg
tataatccggaaggtttggcacagcgtgcagtacgtgcattaaaagcggcttatcctgaa
ttaggcgtgatgactgatgtggcgttagatccattcactacacacggtcaagatggcatt
attgatgaagaaggttatgtactgaatgacatcacaaccgaagtattagtaaaacaagcg
gtatctcacgcagaagctggtgcggatattgttgcaccaagcgatatgatggacggtcgt
atcggtaaaattcgtgaagcacttgaagcgaaaggcttaattaatacgcaaattatggcg
tattcggcgaaatatgcgtcaaattattacgggccgttccgtgatgcggtcggttcggcg
ggtaacttaaaaggcggtaataaatttacttatcaggttgatccggcgaatgcgaacgaa
ggtttacacgaagtggcaatggatattcaagaaggggcggatatggtgatggtaaaaccg
ggtatgccttatttggatatggtatggcgtgtaaaagaaacctttggcgtaccgactttt
gcttatcaagtatccggtgaatacgcaatgcatatggcggcgattcaaaacggctggtta
aaagaacgtgagtgcgttatggaaggtttactttgctttaaacgtgcgggagcggacggt
attttaacctatttcgctaaaacggtagcgaaatggctgtacgaagataatcgtaaataa

DBGET integrated database retrieval system